KEGG   Mus musculus (mouse): 17168Help
Entry
17168             CDS       T01002                                 

Gene name
Nprl3, Aag, CGTHBA, HS-26, HS-40, Mare, Phg, Prox1, m(alpha)RE
Definition
(RefSeq) nitrogen permease regulator-like 3
  KO
K20406  nitrogen permease regulator 3-like protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    17168 (Nprl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17168 (Nprl3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   GATOR1 complex
    17168 (Nprl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPR3 NPR2
Motif
Other DBs
NCBI-GeneID: 17168
NCBI-ProteinID: NP_853547
MGI: 109258
Ensembl: ENSMUSG00000020289
Vega: OTTMUSG00000005378
UniProt: Q8VIJ8
Position
11 A4; 11 18.83 cM
AA seq 569 aa AA seqDB search
MGDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTNKPRSRYAVNNTGEHADDQDG
DSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQVSKTDPSPKREAPT
MILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAM
ADANEGPQSPFQHILPKCKLARDLKEAYDSLCTSGVVRLHINSWLEVSFCLPHKIHYAAS
SLIPPEAIERSLKAIRPYHALLLLSDEKSLLSELPIDCSPALVRVIKTTSAVKNLQQLAQ
DADLALLQVFQLAAHLVYWGKAVIIYPLCENNVYVMSPNASVCLYSPLAEQFSRQFPSHD
LPSVLAKFSLPVSLSEFRSPLAPPAQETQLIQMVVWMLQRRLLIQLHTYVCLMASPSEEE
PRLREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPSGDSPLNK
RMTENLLASLSEHERAAILNVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQL
LMLFDKFRSVLVVTTHEDPVIAVFQALLT
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaataccagccccatcagcgtgatcctggtgagctcgggcagcaggggcaat
aagctgctcttcaggtaccccttccagaggagccaggagcaccccgcgtcccagacaaat
aaaccacggagcagatatgctgtcaacaacactggcgaacatgctgatgaccaggacggt
gactccaggttctcggatgttattctggcaacaattttggcaaccaaatctgaaatgtgc
ggccaaaaatttgaactgaagattgataatgtacggtttgttgggcacccaacactgctg
cagcatgctctggggcaggtctccaaaacagatccatctccaaagcgggaagctccgacc
atgattctttttaacgtggtatttgcactgagggccaatgctgatccatcagtgataaac
tgtctacacaacttgtcccgccgaattgctactgtcctgcagcatgaggagcgccgctgc
cagtacctcactcgagaggccaagctgatcctagcacttcaggatgaggtgtctgctatg
gctgatgcaaatgaaggtcctcagtccccattccagcacatcctacccaagtgcaagctg
gctcgggacctcaaagaagcttatgacagcctgtgcacatctggtgtggtacggcttcac
attaacagctggctggaagtgagtttctgtctgccccacaagatccactatgcagcttca
agtctgattcctcctgaggctattgaacggagcctgaaagccatccgcccgtaccatgcc
ttgctacttctcagtgacgagaagtctctgctgagtgagcttcccattgactgctccccg
gctctggtgcgggtgatcaagaccacgtctgctgtgaagaacctgcagcagctagcccag
gatgccgatctggccttgctgcaggtcttccagttggcagctcacctggtatactggggc
aaggctgtcatcatctacccactgtgtgagaacaacgtctatgtcatgtctcccaatgcc
agtgtgtgtctgtactccccgctagctgaacagttctcccggcagttcccgtcccatgac
ctgccatctgtcctggccaagttttccttgcctgtttctttatcggagttcaggagccct
ctggctccccctgcacaggagacccagctcatccagatggtggtgtggatgctgcagcgc
cggctcctcatccagctgcatacctatgtttgcctaatggcctcacccagcgaagaggag
ccccgactgcgagaggatgatgtccccttcacagccagagttggtggccgcagcctcagc
acacccaatgctctaagctttggctccccaaccagcagtgacgacatgacccttaccagc
cccagtatggacaactcaagtgctgagctgctccccagtggggactcaccactgaacaag
aggatgacagagaacctgctggctagcctctcagagcatgagcgggctgctatcctcaat
gtgcctgcagcccaaaaccctgaggacctccgcatgtttgccaggctccttcactacttc
cgtggccgccaccatctggaggagatcatgtacaatgagaacactcggcgctcccagcta
ctcatgctctttgacaaattccgcagtgtgctggtggtgaccacccatgaggaccctgtt
attgccgtcttccaggcactgctcacatga

DBGET integrated database retrieval system