KEGG   Mus musculus (mouse): 17174
Entry
17174             CDS       T01002                                 

Gene name
Masp1, AW048060, CCPII, Cr, Crarf, Masp1/3
Definition
(RefSeq) mannan-binding lectin serine peptidase 1
  KO
K03992  mannan-binding lectin serine protease 1 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    17174 (Masp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    17174 (Masp1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    17174 (Masp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17174 (Masp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     17174 (Masp1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   17174 (Masp1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA Trypsin_2 CUB_2 cEGF Peptidase_S6 DUF1986
Other DBs
NCBI-GeneID: 17174
NCBI-ProteinID: NP_032581
MGI: 88492
Ensembl: ENSMUSG00000022887
UniProt: P98064
Position
16; 16 B1
AA seq 704 aa
MRFLSFWRLLLYHALCLALPEVSAHTVELNEMFGQIQSPGYPDSYPSDSEVTWNITVPEG
FRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGTFMS
VTFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILH
TDNRTCRVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVSLQFEDIFDIE
DHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQTHSVQILFRSDNSGENRGWRLSYR
AAGNECPKLQPPVYGKIEPSQAVYSFKDQVLVSCDTGYKVLKDNEVMDTFQIECLKDGAW
SNKIPTCKIVDCGAPAGLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCS
AHGTWTNEVLKRSLPTCLPVCGVPKFSRKQISRIFNGRPAQKGTMPWIAMLSHLNGQPFC
GGSLLGSNWVLTAAHCLHQSLDPEEPTLHSSYLLSPSDFKIIMGKHWRRRSDEDEQHLHV
KRTTLHPLYNPSTFENDLGLVELSESPRLNDFVMPVCLPEQPSTEGTMVIVSGWGKQFLQ
RFPENLMEIEIPIVNSDTCQEAYTPLKKKVTKDMICAGEKEGGKDACAGDSGGPMVTKDA
ERDQWYLVGVVSWGEDCGKKDRYGVYSYIYPNKDWIQRITGVRN
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgaggttcctgtctttctggcggctcctcctctaccacgctctgtgcctcgccctgccg
gaggtttcagcccataccgtggagctaaacgaaatgtttggtcagatccagtcacctggc
tatccagattcctatccaagtgactctgaggtgacatggaatattactgtcccggagggg
tttcgaatcaagctttacttcatgcacttcaacttggaatcctcctatctttgtgaatac
gactatgtgaaggtagaaacagaagaccaggtgctggcaaccttttgtggcagggagacc
accgatactgagcagacccccggccaggaagtggttctttcgcctggcaccttcatgtct
gtcactttccggtcagatttctccaatgaggaacgattcacaggcttcgacgcccactac
atggctgtagatgtggatgagtgcaaggagagggaagatgaagagctgtcctgtgaccac
tactgtcacaactacatcggtggctactactgctcctgccgctttggctacatcctccac
acagacaacaggacctgccgagtggaatgcagcggcaatctctttacccagaggacaggc
acaatcaccagccccgattaccccaacccttatcccaagagctcagaatgttcctatacc
attgacctggaggaaggcttcatggtcagcctgcagtttgaggacatttttgacattgaa
gaccatcctgaggtgccctgtccctatgactacattaagattaaagctggttcaaaagta
tggggtcccttctgtggagagaaatccccagaaccaatcagcacccagactcacagtgtc
cagatcctattccgcagcgacaactcaggagagaaccgaggctggaggctctcctacaga
gcggcaggaaatgagtgcccaaagctacagcctcctgtgtacgggaaaatcgagccctcg
caggccgtgtattccttcaaagaccaagtgctcgtcagctgtgacacaggctacaaagtg
ctaaaggataacgaggtgatggacacattccaaattgagtgtctgaaggacggtgcatgg
agtaacaagatccccacctgtaaaattgtagactgtggagctcctgcagggctgaaacat
gggctagtaaccttctccaccagaaacaacctcaccacatacaaatctgagataaggtac
tcctgccaacagccctattacaagatgcttcacaataccacaggtgtatatacgtgttct
gctcatgggacctggacgaacgaagtgctcaagagaagcctgcccacctgccttccagtg
tgtggtgtccccaagttctcccggaagcagatctccaggatcttcaatggccgcccagcc
cagaagggtaccatgccatggattgccatgctgtcacacctgaacggacaacccttctgt
gggggtagccttttaggttccaactgggttttgacagctgctcactgcctccaccagtca
cttgatccagaagaaccaaccctacacagctcatacttgctcagcccttctgacttcaaa
attatcatgggaaagcactggagacggcgctcagacgaagacgagcagcacctgcatgta
aagcgcaccacgctccacccactgtacaaccccagcacgtttgagaacgaccttggtctg
gtggaactgtcagagagcccgaggctgaacgactttgtgatgcctgtctgtctgcctgag
cagccttccactgaaggaaccatggtcatcgtcagtggctgggggaagcagttcttacag
aggtttccagagaacctgatggagattgaaatcccaattgtaaactctgacacctgccag
gaggcctataccccattgaagaagaaagtgaccaaggacatgatctgtgccggagaaaag
gaaggggggaaagatgcctgtgctggtgactctggaggccctatggtgaccaaagatgca
gagagagaccaatggtacctggtgggcgtggtgtcctggggtgaagattgcgggaagaaa
gatcgctatggagtctattcttacatctatcccaacaaggactggatccagaggatcact
ggggtgaggaactga

KEGG   Mus musculus (mouse): 17175
Entry
17175             CDS       T01002                                 

Gene name
Masp2, MAS, MASP-2, MAp, MAp19
Definition
(RefSeq) mannan-binding lectin serine peptidase 2
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    17175 (Masp2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    17175 (Masp2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    17175 (Masp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17175 (Masp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     17175 (Masp2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   17175 (Masp2)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA cEGF EGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 17175
NCBI-ProteinID: NP_001003893
MGI: 1330832
Ensembl: ENSMUSG00000028979
Vega: OTTMUSG00000010952
UniProt: Q91WP0
Position
4; 4 E2
AA seq 685 aa
MRLLIFLGLLWSLVATLLGSKWPEPVFGRLVSPGFPEKYADHQDRSWTLTAPPGYRLRLY
FTHFDLELSYRCEYDFVKLSSGTKVLATLCGQESTDTEQAPGNDTFYSLGPSLKVTFHSD
YSNEKPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNYLGGYYCSCRAGYVLHQNKHTC
SALCSGQVFTGRSGYLSSPEYPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQ
CPYDSLKIQTDKGEHGPFCGKTLPPRIETDSHKVTITFATDESGNHTGWKIHYTSTARPC
PDPTAPPNGSISPVQAIYVLKDRFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPMPE
CSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSS
KGEKLPPVCEPVCGLSTHTIGGRIVGGQPAKPGDFPWQVLLLGQTTAAAGALIHDNWVLT
AAHAVYEKRMAASSLNIRMGILKRLSPHYTQAWPEEIFIHEGYTHGAGFDNDIALIKLKN
KVTINGSIMPVCLPRKEAASLMRTDFTGTVAGWGLTQKGLLARNLMFVDIPIADHQKCTA
VYEKLYPGVRVSANMLCAGLETGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCG
AADQYGVYTKVINYIPWIENIISNF
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgaggctactcatcttcctgggtctgctgtggagtttggtggccacacttctgggttca
aagtggcctgaacctgtattcgggcgcctggtgtcccctggcttcccagagaagtatgct
gaccatcaagatcgatcctggacactgactgcaccccctggctaccgcctgcgcctctac
ttcacccactttgacctggaactctcttaccgctgcgagtatgactttgtcaagttgagc
tcagggaccaaggtgctggccacactgtgtgggcaggagagtacagacactgagcaggca
cctggcaatgacaccttctactcactgggtcccagcctaaaggtcaccttccactccgac
tactccaatgagaagccgttcacagggtttgaggccttctatgcagcggaggatgtggat
gaatgcagagtgtctctgggagactcagtcccttgtgaccattattgccacaactacttg
ggcggctactattgctcctgcagagcgggctacgttctccaccagaacaagcacacgtgc
tcagccctttgttcaggccaggtgttcacaggaagatctgggtatctcagtagccctgag
tacccacagccataccccaagctctccagctgcacctacagcatccgcctggaggacggc
ttcagtgtcatcctggacttcgtggagtccttcgatgtggagacgcaccctgaagcccag
tgcccctatgactccctcaagattcaaacagacaagggggaacacggcccattttgtggg
aagacgctgcctcccaggattgaaactgacagccacaaggtgaccatcacctttgccact
gacgagtcggggaaccacacaggctggaagatacactacacaagcacagcacggccctgc
cctgatccaacggcgccacctaatggcagcatttcacctgtgcaagccatatatgtcctg
aaggacaggttttctgtcttctgcaagacaggcttcgagcttctgcaaggttctgtcccc
ctgaaatcattcactgctgtctgtcagaaagatggatcttgggaccggccgatgccagag
tgcagcattattgattgtggccctcctgatgacctacccaatggccatgtggactatatc
acaggccctgaagtgactacctacaaagctgtgattcagtacagctgtgaagagactttc
tacacaatgagcagcaatggtaaatatgtgtgtgaggctgatggattctggacgagctcc
aaaggagaaaaactccccccggtttgtgagcctgtttgtgggctgtccacacacactata
ggaggacgcatagttggagggcagcctgcaaagcctggtgactttccttggcaagtcttg
ttgctgggtcaaactacagcagcagcaggtgcacttatacatgacaattgggtcctaaca
gccgctcatgctgtatatgagaaaagaatggcagcgtcctccctgaacatccgaatgggc
atcctcaaaaggctctcacctcattacactcaagcctggcccgaggaaatctttatacat
gaaggctacactcacggtgctggttttgacaatgatatagcattgattaaactcaagaac
aaagtcacaatcaacggaagcatcatgcctgtttgcctaccgcgaaaagaagctgcatcc
ttaatgagaacagacttcactggaactgtggctggctgggggttaacccagaaggggctt
cttgctagaaacctaatgtttgtggacataccaattgctgaccaccaaaaatgtaccgcc
gtgtatgaaaagctctatccaggagtaagagtaagcgctaacatgctctgtgctggctta
gagactggtggcaaggacagctgcagaggtgacagtgggggggcattagtgtttctagat
aatgagacacagcgatggtttgtgggaggaatagtttcctggggttccattaattgtggg
gcggcagaccagtatggggtctacacaaaagtcatcaactatattccctggattgagaac
ataataagtaatttctaa

DBGET integrated database retrieval system