KEGG   Mus musculus (mouse): 17194
Entry
17194             CDS       T01002                                 

Gene name
Mbl1, MBL, MBL-A, MBP, MBP-A, S-MBP
Definition
(RefSeq) mannose-binding lectin (protein A) 1
  KO
K03991  mannose-binding lectin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17194 (Mbl1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    17194 (Mbl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    17194 (Mbl1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    17194 (Mbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17194 (Mbl1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    17194 (Mbl1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    17194 (Mbl1)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 3: Collectins
   17194 (Mbl1)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 17194
NCBI-ProteinID: NP_034905
MGI: 96923
Ensembl: ENSMUSG00000037780
UniProt: P39039
Position
14 B; 14 22.36 cM
AA seq 239 aa
MLLLPLLPVLLCVVSVSSSGSQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQG
PPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFS
MGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDE
ATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcttctgcttccattactccctgtccttctgtgtgtggtgagtgtgtcctcatcaggg
tcacaaacctgtgaggacaccctgaagacttgctctgtgatagcctgtggcagagatggg
agagatggacccaaaggggagaagggagaaccaggtcaagggctcaggggcttgcagggc
cctccagggaaattggggcctccaggaagtgttggaagccctggaagtccaggaccaaaa
ggccaaaagggggaccatggagacaatagagccattgaggagaagctggcaaatatggag
gcagagataaggatcctgaaatcaaaactgcagctaaccaacaagttgcatgccttctca
atgggcaaaaagtctgggaagaagttgtttgtgaccaaccatgagaagatgcccttttcc
aaagtgaagtctctgtgcacagagctccaaggcactgtggctatccccaggaatgctgaa
gagaacaaggccattcaagaagtggccacaggcattgccttcctaggcatcacggacgag
gcgactgaagggcagttcatgtacgtgacaggggggaggctcacctacagcaactggaaa
aaggatgagccaaataaccatggctctggggaagactgtgtcattatattagataatggt
ttgtggaatgacatttcctgtcaagcttccttcaaggctgtctgcgagttcccagcctga

KEGG   Mus musculus (mouse): 17195
Entry
17195             CDS       T01002                                 

Gene name
Mbl2, L-MBP, MB, MBL, MBL-, MBL-C, MBP-, MBP-C, RARF/P28A
Definition
(RefSeq) mannose-binding lectin (protein C) 2
  KO
K03991  mannose-binding lectin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    17195 (Mbl2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    17195 (Mbl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    17195 (Mbl2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    17195 (Mbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17195 (Mbl2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    17195 (Mbl2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    17195 (Mbl2)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 3: Collectins
   17195 (Mbl2)
SSDB
Motif
Pfam: Lectin_C Collagen Helo_like_N
Other DBs
NCBI-GeneID: 17195
NCBI-ProteinID: NP_034906
MGI: 96924
Ensembl: ENSMUSG00000024863
UniProt: P41317 Q3UEK1
Position
19 C1; 19 25.14 cM
AA seq 244 aa
MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQ
GLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRN
WVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYL
GITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAIC
EFSD
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtccattttcacatccttccttctgctgtgtgtggtgacagtggtttatgcagagacc
ttaaccgaaggtgttcaaaattcctgccctgtggttacctgcagttctccaggcctgaat
ggcttcccaggcaaagatggacgtgacggtgccaagggagaaaagggagaaccaggtcaa
gggctcagaggcttgcaaggccctcctggaaaagtaggacctacaggacccccagggaat
ccggggttaaaaggagcagtgggaccgaaaggagaccgtggggacagagcagaatttgat
actagcgaaattgattcagaaattgcagccctacgatcagagctgagagccctgagaaac
tgggtgctcttctctctgagtgaaaaagttggaaagaagtattttgtgagcagtgttaaa
aagatgagccttgacagagtgaaggccctgtgctccgaattccagggctctgtggccact
cccaggaatgctgaggaaaactcggccatccagaaagtggccaaagatattgcctacttg
ggcatcacagatgtgagggttgaaggcagttttgaggatctgacaggaaacagagtgcgc
tatactaattggaatgatggggagcccaacaacacgggcgatggggaagactgtgtggtg
atcttgggaaatggcaagtggaacgatgtcccctgctctgactcttttttggcaatctgt
gaattctctgactga

DBGET integrated database retrieval system