KEGG   Mus musculus (mouse): 17196Help
Entry
17196             CDS       T01002                                 

Gene name
Mbp, C76307, Hmbpr, R75289, golli-mbp, jve, mld, shi
Definition
(RefSeq) myelin basic protein
  KO
K17269  myelin basic protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    17196 (Mbp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17196 (Mbp)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     17196 (Mbp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   17196 (Mbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myelin_MBP
Motif
Other DBs
NCBI-GeneID: 17196
NCBI-ProteinID: NP_034907
MGI: 96925
Ensembl: ENSMUSG00000041607
Vega: OTTMUSG00000016316
UniProt: P04370
Structure
PDB: 

Position
18 E3; 18 55.84 cM
AA seq 250 aa AA seqDB search
MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAE
DTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTI
QEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGD
RGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRD
SRSGSPMARR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccactctggaaagagagaattatctgctgagaaggccagtaaggatggagag
attcaccgaggagaggctggaaagaagagaagcgtgggcaagctttctcagacggcctca
gaggacagtgatgtgtttggggaggcagatgcgatccagaacaatgggacctcggctgag
gacacggcggtgacagactccaagcacacagcagacccaaagaataactggcaaggcgcc
cacccagctgacccagggaaccgcccccacttgatccgcctcttttcccgagatgccccg
ggaagggaggacaacaccttcaaagacaggccctcagagtccgacgagcttcagaccatc
caagaagaccccacagcagcttccggaggcctggatgtgatggcatcacagaagagaccc
tcacagcgatccaagtacctggccacagcaagtaccatggaccatgccaggcatggcttc
ctcccaaggcacagagacacgggcatccttgactccatcgggcgcttctttagcggtgac
aggggtgcgcccaagcggggctctggcaaggactcacacacgagaactacccattatggc
tccctgccccagaagtcgcagcacggccggacccaagatgaaaacccagtagtccatttc
ttcaagaacattgtgacacctcgaacaccacctccatcccaagggaagggaggaagagac
agccgctctggatctcccatggcgagacgctga

DBGET integrated database retrieval system