KEGG   Mus musculus (mouse): 17199Help
Entry
17199             CDS       T01002                                 

Gene name
Mc1r, Mcr1, Mshra, Tob, e
Definition
(RefSeq) melanocortin 1 receptor
  KO
K04199  melanocortin 1 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    17199 (Mc1r)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    17199 (Mc1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    17199 (Mc1r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Melanocortin
    17199 (Mc1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Pox_A14
Motif
Other DBs
NCBI-GeneID: 17199
NCBI-ProteinID: NP_032585
MGI: 99456
Ensembl: ENSMUSG00000074037
Vega: OTTMUSG00000051105
UniProt: Q01727 A0A0B6VTJ4
Position
8 E1; 8 72.1 cM
AA seq 315 aa AA seqDB search
MSTQEPQKSLLGSLNSNATSHLGLATNQSEPWCLYVSIPDGLFLSLGLVSLVENVLVVIA
ITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARVALVQQLDNLIDV
LICGSMVSSLCFLGIIAIDRYISIFYALRYHSIVTLPRARRAVVGIWMVSIVSSTLFITY
YKHTAVLLCLVTFFLAMLALMAILYAHMFTRACQHAQGIAQLHKRRRSIRQGFCLKGAAT
LTILLGIFFLCWGPFFLHLLLIVLCPQHPTCSCIFKNFNLFLLLIVLSSTVDPLIYAFRS
QELRMTLKEVLLCSW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcaggagccccagaagagtcttctgggttctctcaactccaatgccacctct
caccttggactggccaccaaccagtcagagccttggtgcctgtatgtgtccatcccagat
ggcctcttcctcagcctagggctggtgagtctggtggagaatgtgctggttgtgatagcc
atcaccaaaaaccgcaacctgcactcgcccatgtattacttcatctgctgcctggccctg
tctgacctgatggtaagtgtcagcatcgtgctggagactactatcatcctgctgctggag
gcgggcatcctggtggccagagtggctttggtgcagcagctggacaacctcattgacgtg
ctcatctgtggctccatggtgtccagtctctgcttcctgggcatcattgctatagaccgc
tacatctccatcttctatgcgctgcgttatcacagcatcgtgacgctgcccagagcacga
cgggctgtcgtgggcatctggatggtcagcatcgtctccagcaccctctttatcacctac
tacaagcacacagccgttctgctctgcctcgtcactttctttctagccatgctggcactc
atggcgattctgtatgcccacatgttcacgagagcgtgccagcacgctcagggcattgcc
cagctccacaaaaggcggcggtccatccgccaaggcttctgcctcaagggtgctgccacc
cttactatccttctggggattttcttcctgtgctggggccccttcttcctgcatctcttg
ctcatcgtcctctgccctcagcaccccacctgcagctgcatcttcaagaacttcaacctc
ttcctcctcctcatcgtcctcagctccactgttgaccccctcatctatgctttccgcagc
caggagctccgcatgacactcaaggaggtgctgctgtgctcctggtga

DBGET integrated database retrieval system