KEGG   Mus musculus (mouse): 17200
Entry
17200             CDS       T01002                                 

Gene name
Mc2r, ACTH-R, ACTHR, Act, MC2-R
Definition
(RefSeq) melanocortin 2 receptor
  KO
K04200  melanocortin 2 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    17200 (Mc2r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    17200 (Mc2r)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    17200 (Mc2r)
   04927 Cortisol synthesis and secretion
    17200 (Mc2r)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    17200 (Mc2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    17200 (Mc2r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Melanocortin
    17200 (Mc2r)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 17200
NCBI-ProteinID: NP_001258645
MGI: 96928
Ensembl: ENSMUSG00000045569
UniProt: Q64326 Q544P9
Position
18 E2; 18 41.89 cM
AA seq 296 aa
MKHIINSYEHTNDTARNNSDCPDVVLPEEIFFTISVIGILENLIVLLAVIKNKNLQSPMY
FFICSLAISDMLGSLYKILENILIMFRNMGYLKPRGSFESTADDIIDCMFILSLLGSIFS
LSVIAADRYITIFHALQYHSIVTMRRTIITLTIIWMFCTGSGITMVIFSHHIPTVLTFTS
LFPLMLVFILCLYIHMFLLARSHARKISTLPRTNMKGAMTLTILLGVFIFCWAPFVLHVL
LMTFCPNNPYCVCYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKRMLFCNRY
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaagcatattatcaattcgtatgaacacaccaatgacaccgcaagaaataactccgat
tgtcctgatgtagttttgccagaagagatatttttcacaatctctgtcattggcatattg
gagaacttgattgtcctcctggctgtgatcaaaaataaaaatctccagtcccccatgtat
tttttcatctgcagtttggccatttctgacatgttgggcagtctgtataagatcttggaa
aacatcctgatcatgttcagaaacatgggttatcttaagcctcgtggcagttttgaaagc
acagcagatgacatcattgactgcatgttcatcctctctttgctgggctctatcttcagc
ctgtctgtcattgcagctgaccgttacatcaccatcttccatgccctgcaataccatagc
attgtgaccatgcgccgcaccatcatcaccctaacaattatctggatgttctgcacaggg
agcggcatcaccatggtgatcttctcccaccacatccccacagtgctcaccttcacatcg
ctgttccctttgatgctggtttttatcctgtgtctctacatccacatgttcttacttgcc
cgctcccatgctaggaagatctctacccttcctagaaccaacatgaagggtgccatgaca
ctaaccatccttcttggagtcttcatcttctgttgggccccctttgtgctccatgttctc
ttaatgaccttctgcccaaataacccttactgtgtttgctacatgtctctcttccaggtc
aatggcatgttgatcatgtgcaatgcagttattgacccctttatatatgcctttcggagc
ccagagctcagagatgcattcaaaaggatgctcttctgcaaccggtattag

DBGET integrated database retrieval system