KEGG   Mus musculus (mouse): 17201Help
Entry
17201             CDS       T01002                                 

Gene name
Mc3r, MC3-R
Definition
(RefSeq) melanocortin 3 receptor
  KO
K04201  melanocortin 3 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    17201 (Mc3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    17201 (Mc3r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Melanocortin
    17201 (Mc3r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 17201
NCBI-ProteinID: NP_032587
MGI: 96929
Ensembl: ENSMUSG00000038537
Vega: OTTMUSG00000016156
UniProt: P33033 Q544G7
Position
2 H3; 2 94.8 cM
AA seq 323 aa AA seqDB search
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI
IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNSMNLG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcctgctgcctgtcttctgtttctccgatgctgcctaacctctctgagcac
cctgcagcccctcctgccagcaaccggagcggcagtgggttctgtgagcaggtcttcatc
aagccggaggtcttcctggctctgggcatcgtcagtctgatggaaaacatcctggtgatc
ctggctgtggtcaggaatggcaacctgcactctcccatgtacttcttcctgtgcagcctg
gctgcagccgacatgctggtgagcctgtccaactccctggagaccatcatgatcgccgtg
atcaacagcgactccctgaccttggaggaccagtttatccagcacatggataatatcttc
gactctatgatttgcatctccctggtggcctccatctgcaacctcctggccattgccatc
gacaggtacgtcaccatcttctatgcccttcggtaccacagcatcatgacagtgaggaaa
gccctcaccttgatcggggtcatctgggtctgctgcggcatctgcggcgtgatgttcatc
atctactccgagagcaagatggtcatcgtgtgtctcatcaccatgttcttcgccatggtg
ctcctcatgggcaccctatatatccacatgttcctcttcgccaggctccacgtccagcgc
atcgcagtgctgccccctgctggcgtggtggccccacagcagcactcctgcatgaagggg
gctgtcaccatcactatcctgctgggtgttttcatcttctgctgggcgcctttcttcctc
cacctggtcctcatcatcacctgccccaccaatccctactgcatctgctacacggcccat
ttcaacacctacctggttctcatcatgtgcaactccgtcatcgaccccctcatctacgcc
ttccgcagcctggagctgcgcaacacgttcaaggagattctctgcggctgcaacagcatg
aacttgggctag

DBGET integrated database retrieval system