KEGG   Mus musculus (mouse): 17202Help
Entry
17202             CDS       T01002                                 

Gene name
Mc4r, Mc4-r, Pkcp
Definition
(RefSeq) melanocortin 4 receptor
  KO
K04202  melanocortin 4 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    17202 (Mc4r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Melanocortin
    17202 (Mc4r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 17202
NCBI-ProteinID: NP_058673
MGI: 99457
Ensembl: ENSMUSG00000047259
UniProt: P56450
Position
18; 18 E1
AA seq 332 aa AA seqDB search
MNSTHHHGMYTSLHLWNRSSYGLHGNASESLGKGHPDGGCYEQLFVSPEVFVTLGVISLL
ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN
IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS
GVLFIIYSDSSAVIICLISMFFTMLVLMASLYVHMFLMARLHIKRIAVLPGTGTIRQGTN
MKGAITLTILIGVFVVCWAPFFLHLLFYISCPQNPYCVCFMSHFNLYLILIMCNAVIDPL
IYALRSQELRKTFKEIICFYPLGGICELSSRY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaactccacccaccaccatggcatgtatacttccctccacctctggaaccgcagcagc
tacgggctgcacggcaatgccagcgagtcgctggggaagggccacccggacggaggatgc
tatgagcaactttttgtttcccccgaggtgtttgtgactctgggtgtcataagcctgttg
gagaacattctagtgatcgtggcgatagccaagaacaagaacctgcactcacccatgtac
tttttcatctgtagcctggctgtggcagatatgctggtgagcgtttcgaatgggtcggaa
accatcgtcattaccctgttaaacagtacggatacggatgcccagagcttcaccgtgaac
attgataatgtcattgactctgtgatctgtagctccttgctcgcatccatttgcagcctg
ctttccattgcggtggacaggtatttcactatcttttacgcgctccagtaccataacatc
atgacggttaggcgggtcgggatcatcataagttgtatctgggcagcttgcactgtgtca
ggcgtcctcttcatcatttactcggacagcagcgctgtcatcatctgcctcatttccatg
ttcttcactatgctagttctcatggcctctctctatgtccacatgttcctgatggcgagg
cttcacattaagaggattgctgtcctcccaggcacagggaccatccgccagggtaccaac
atgaagggggcgattaccttgaccatcctgattggagtctttgttgtctgctgggccccg
ttctttctccatttactgttctacatctcttgccctcagaatccatactgcgtgtgcttc
atgtctcattttaatttgtatctcatactgatcatgtgtaacgccgtcatcgaccctctc
atttatgccctccggagtcaagaactgaggaaaactttcaaagagatcatctgtttctat
cctctgggaggcatctgtgagttgtctagcaggtattaa

DBGET integrated database retrieval system