KEGG   Mus musculus (mouse): 17203
Entry
17203             CDS       T01002                                 

Gene name
Mc5r
Definition
(RefSeq) melanocortin 5 receptor
  KO
K04203  melanocortin 5 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    17203 (Mc5r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    17203 (Mc5r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Melanocortin
    17203 (Mc5r)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx Syd
Other DBs
NCBI-GeneID: 17203
NCBI-ProteinID: NP_038624
MGI: 99420
Ensembl: ENSMUSG00000007480
UniProt: P41149 Q496T0 G3UWB6
Position
18 E2; 18 41.46 cM
AA seq 325 aa
MNSSSTLTVLNLTLNASEDGILGSNVKNKSLACEEMGIAVEVFLTLGLVSLLENILVIGA
IVKNKNLHSPMYFFVGSLAVADMLVSMSNAWETVTIYLLNNKHLVIADTFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYITIFYALRYHHIMTARRSGVIIACIWTFCISCGIVFIIY
YESKYVIICLISMFFTMLFFMVSLYIHMFLLARNHVKRIAASPRYNSVRQRTSMKGAITL
TMLLGIFIVCWSPFFLHLILMISCPQNVYCSCFMSYFNMYLILIMCNSVIDPLIYALRSQ
EMRRTFKEIVCCHGFRRPCRLLGGY
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaactcctcctccaccctgactgtattgaatcttaccctgaacgcctcagaggatggc
attttaggatcaaatgtcaagaacaagtctttggcctgtgaagaaatgggcattgccgtg
gaggtgttcctgaccctgggtctcgtcagcctcttagagaacatcctggtcattggggcc
atagtaaagaacaaaaacctgcactcacccatgtacttctttgtgggcagcttagccgtg
gccgacatgctggtgagcatgtccaatgcctgggagactgtcaccatatacttgctaaat
aataaacacctggtgatagccgacacctttgtgcgacacatcgacaacgtgttcgactcc
atgatctgcatctctgtggtggcctcgatgtgcagtttgctggccattgcggtggacagg
tacatcaccatcttctatgccttgcgctaccaccacatcatgaccgcgaggcgctcgggg
gtgatcatcgcctgcatctggaccttctgcataagctgcggcattgttttcatcatctac
tatgagtccaagtatgtgatcatttgcctcatctccatgttcttcaccatgctgttcttc
atggtgtctctgtatatacacatgttcctcctggcccggaaccatgtcaagcggatagca
gcttcccccagatacaactccgtgaggcaaaggaccagcatgaagggggctattaccctc
accatgctactggggattttcattgtctgctggtctcccttctttcttcaccttatctta
atgatctcctgccctcagaacgtctactgctcttgctttatgtcttacttcaacatgtac
cttatactcatcatgtgcaactccgtgatcgatcctctcatctacgccctccgcagccaa
gagatgcggaggacctttaaggagatcgtctgttgtcacggattccggcgaccttgtagg
ctccttggcgggtattaa

DBGET integrated database retrieval system