KEGG   Mus musculus (house mouse): 17210
Entry
17210             CDS       T01002                                 
Symbol
Mcl1, Mcl-1
Name
(RefSeq) myeloid cell leukemia sequence 1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    17210 (Mcl1)
   04151 PI3K-Akt signaling pathway
    17210 (Mcl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    17210 (Mcl1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    17210 (Mcl1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 17210
NCBI-ProteinID: NP_032588
MGI: 101769
Ensembl: ENSMUSG00000038612
UniProt: P97287
Structure
Position
3:95564017..95583553
AA seq 331 aa
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 996 nt   +upstreamnt  +downstreamnt
atgtttggcctgcggagaaacgcggtcatcggcttgaacctgtactgcggcggcgccagc
ctcggcgcgggcggcggttctccggcaggggcgcgcctggtggccgaggaggccaaggcg
cggcgcgaggggggaggggaggccgccctgctgcccggcgcgcgggtggtcgcccggccg
ccgcccgtgggcgccgaggaccccgacgtcaccgcgtcggccgaaaggcggctgcataag
tcgcccggcctcctcgccgtgccgcccgaggagatggccgcgtcggccgccgccgccatc
gtgtctccggaggaggaactggacggctgcgagccggaggccatcggcaagcgcccggcc
gtgctgcccctcctggagcgcgtgagcgaggcggccaagagctccggggccgacggctct
ctgccctccacgccgccgccgcccgaggaggaagaggacgacctataccgccagtcgctg
gagatcatctcgcgctacttgcgggagcaggcgaccggctccaaggactcgaagcctctg
ggcgaggcgggcgcggcgggccggagagcgctggagaccctgcggcgcgtgggcgacggc
gtgcagcgcaaccacgagacggccttccagggcatgctccggaaactggacattaaaaac
gaaggcgatgttaaatctttttctcgagtaatggtccatgttttcaaagatggcgtaaca
aactggggcaggattgtgactcttatttctttcggtgcctttgtggccaaacacttaaag
agcgtaaaccaagaaagcttcatcgaaccattagcagaaactatcacagatgttcttgta
aggacgaaacgggactggcttgtcaaacaaagaggctgggatgggtttgtggagttcttc
cacgtacaggacctagaaggcggcatcagaaatgtgctgctggcttttgcgggtgttgct
ggagtaggggctggtctggcatatctaataagatag

DBGET integrated database retrieval system