KEGG   Mus musculus (mouse): 17215
Entry
17215             CDS       T01002                                 

Gene name
Mcm3, AL033361, C80350, Mcmd, P, P1, P1-MCM3, p1., p1.m
Definition
(RefSeq) minichromosome maintenance complex component 3
  KO
K02541  DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17215 (Mcm3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17215 (Mcm3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17215 (Mcm3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17215 (Mcm3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17215 (Mcm3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17215 (Mcm3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    17215 (Mcm3)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Other DBs
NCBI-GeneID: 17215
NCBI-ProteinID: NP_032589
MGI: 101845
Ensembl: ENSMUSG00000041859
Vega: OTTMUSG00000048358
UniProt: P25206 Q3UI57
Position
1; 1 A4
AA seq 812 aa
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEK
RANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSFGSKHVSPRTLTSCF
LSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEE
NNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGT
YRCLPGKKGCYTSGTFRTVLIACNVKQMSKDIQPAFSADDIAKIKKFSKTRSKDVFEQLA
RSLAPSIHGHDYVKKAILCLLLGGVERELENGSHIRGDINILLIGDPSVAKSQLLRYVLC
TAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFD
LLFIMLDQMDPEQDREISDHVLRMHQYRAPGEQDGDALPLGSSVDILATDDPDFTQDDQQ
DTRIYEKHDSLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPTLTQESAAYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEK
EKKRKKASEDESDLEDEEEKSQEDTEQKRKRRKTHAKDGESYDPYDFSEAETQMPQVHTP
KTDDSQEKTDDSQETQDSQKVELSEPRLKAFKAALLEVFQEAHEQSVGMLHLTESINRNR
EEPFSSEEIQACLSRMQDDNQVMVSEGIVFLI
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggcgggcacagtagtgctggatgatgtggagctgcgggaagcgcagagagactacttg
gacttcctggatgacgaggaggaccaaggcatttaccagaacaaggttcgggaactgatc
agtgacaatcagtatcggctgattgtcagcgtgaatgacctgcgcaggaagaatgaaaag
agggctaaccgcctcctgaacaatgcgtttgaggagctggttgccttccagcgggccttg
aaggatttcgtggcctccattgacgccacctacgccaagcagtatgaggagttctacata
ggattggaaggcagctttggctcaaagcacgtctctccccggactctcacttcctgcttc
ctcagctgtgtggtctgtgtggaaggcattgttactaaatgctctctggttcgccccaaa
gtcgttcgcagtgttcactactgtcctgctactaagaagaccatagagcgacgctactct
gacctcaccaccctagtggctttcccatccagttctgtttatcccacaaaggatgaggag
aacaaccccctggagacagagtatggcctgtctgtctacaaggaccatcagaccatcacc
atccaggagatgccagagaaggcccctgctggtcagctccctcgctctgtggatgtcatt
ctagacgatgacctggtggataaagtgaagcctggtgacagaatacaggtggtggggacc
taccgctgccttccagggaagaagggctgctacacctcggggaccttcaggaccgtcctg
attgcctgtaatgtgaagcagatgagtaaggatattcagcctgcattctctgcggacgat
atagccaagatcaagaagttcagcaaaactcgttccaaggatgtctttgagcagctggcc
cggtcgttagccccgagcatccatgggcatgactatgtcaagaaggcaatcctctgcttg
ctcctgggaggggtggagcgggaacttgaaaacggcagccacatccgtggagacatcaat
attcttctaataggtgacccctccgttgccaagtcccagcttctgcggtacgtgctttgc
acggcgcccagggccattcccaccacgggacggggctcctctggagtgggtctcacagct
gctgtcactacagaccaggaaacaggggagcgccgcctggaagctggtgctatggtcctg
gctgaccgtggagtggtttgcattgatgagtttgacaagatgtctgacatggaccgcaca
gccatccacgaggtgatggagcagggtcgagtgaccattgcaaaggctggcatccatgcc
cggctcaatgcccgctgcagtgttttggcagctgccaatccagtctatggcaggtatgat
cagtataagacgcccatggagaacattgggctgcaggactcactgctgtctagatttgac
ctgctcttcatcatgctggatcagatggatcctgaacaggatcgggagatctcagaccac
gtcctgaggatgcaccaatacagggccccgggggagcaggacggtgatgctttgccattg
ggtagttcagtggatatcctggccacagacgatcctgactttacccaggatgaccagcaa
gatacccgcatttatgagaagcatgacagccttctacatgggaccaagaagaaaaaggag
aagatggtgagcgcagcttttatgaagaagtacattcacgtggccaaaattatcaagccc
accctgacacaggagtcagcagcctacattgcagaagaatactcacgcctgcgcagccag
gacagtatgagctcagacactgcccggacatctccagttacagcacggacactggaaact
ctgattcgactggccacggcccatgcgaaggcccggatgagcaagactgtggacctgcag
gatgcagaggaagccgtggagctggttcagtatgcttatttcaagaaggttctggagaag
gagaagaaacgtaagaaggcaagtgaggatgaatcagacctagaagatgaagaggaaaag
agccaggaagacactgagcagaagcggaaaaggaggaagactcatgccaaggatggagag
tcctatgacccttacgacttcagtgaagcagagacgcagatgcctcaagtgcacacccca
aagactgacgattcccaagagaagaccgatgattctcaggagacccaggactcccagaaa
gtggaactcagtgagcccaggctgaaggcttttaaggcggccctcttagaagtgttccag
gaagctcatgagcagtctgtgggcatgctccacctcacagaatccatcaaccggaataga
gaagagccgttctcctcagaggaaatccaggcttgcctgagccggatgcaggatgataac
caggtcatggtgtctgagggcatcgtcttccttatctga

DBGET integrated database retrieval system