KEGG   Mus musculus (mouse): 17216
Entry
17216             CDS       T01002                                 

Gene name
Mcm2, AA959861, AW476101, BM28, CDCL, CDCL1, Mcmd2, mKIAA0030
Definition
(RefSeq) minichromosome maintenance complex component 2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17216 (Mcm2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17216 (Mcm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17216 (Mcm2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17216 (Mcm2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17216 (Mcm2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17216 (Mcm2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    17216 (Mcm2)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM2_N MCM_N Mg_chelatase AAA_3 AAA_5 DUF445 AAA_lid_2 AAA AAA_2 Sigma54_activ_2
Other DBs
NCBI-GeneID: 17216
NCBI-ProteinID: NP_032590
MGI: 105380
Ensembl: ENSMUSG00000002870
Vega: OTTMUSG00000057511
UniProt: P97310
Position
6; 6 D1
AA seq 904 aa
MAESSESLSASSPARQRRRISDPLTSSPGRSSRRADALTSSPGRDLPPFEDESEGLLGTE
GPMEEEEDGEELIGDGMERDYRPIPELDVYEAEGLALDDEDVEELTASQREAAERTMRQR
DREAGRGLGRMRRGLLYDSSEEDEERPARKRRHVERATEDGEEDEEMIESIENLEDLKGH
SVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAR
EHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQL
HLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFVLGPFCQSQNQEVKPGSCPECQSAGP
FEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN
NYDGSLNTANGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITGLSKDQQIGEKIFAS
IAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS
SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSI
HEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVL
CVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTLEPAMPNTYGVEPLPQEVL
KKYIIYAKERVRPKLNQMDQDKVARMYSDLRKESMATGSIPITVRHIESMIRMAEAHARM
HLRDYVMEDDVNMAIRVMMESFIDTQKFSVMRSMRKTFARYLSFRRDNNDLLLFILKQLV
AEQVTYQRNRFGAQQDTIEIPEKDLMDKARQINIHNLSAFYDSDLFKFNKFSRDLKRKLI
LQQF
NT seq 2715 nt   +upstreamnt  +downstreamnt
atggcggagtcttctgagtctctctcagcatctagccctgcccgtcagcggcgccggatc
agtgatcccctcacctccagcccaggccgcagctccagacgtgctgacgccctgacctcc
agccctggcagagacctccccccatttgaagatgagtctgaggggctgctgggcacagag
gggcccatggaggaagaagaggatggagaggaactcattggtgatggcatggagagagac
taccgtcccattccggagctcgatgtctacgaggccgagggattggccctggatgatgaa
gatgtggaggagctgacagccagtcagagagaggcagctgagcggaccatgaggcagcgg
gaccgtgaggctggcagaggcctgggacgcatgcgccgggggctgctctatgacagcagc
gaggaagatgaggagcggcctgcccgtaagcgccgccacgtagaacgcgccacagaggat
ggcgaggaggatgaagagatgatcgagagtattgagaatctggaggacctcaagggccac
tcggtgcgcgagtgggtgagcatggcagggcccaggctggagatccaccaccgcttcaag
aacttcctgcgcacccacgtggacagccatggccacaacgtcttcaaggagcgcatcagt
gatatgtgcaaagagaaccgtgagagtttggtggtaaattatgaagacctggcagcccgg
gagcacgtgttggcatacttcctgccggaagcaccggctgagttgctgcagatctttgac
gaggctgccctggaggtcgtgttggccatgtaccctaaatatgaccgtatcaccaaccac
atccatgtgcgcatctcccacctgcctctggtggaggagctgcgttcactgaggcagttg
cacctgaaccagctgatccgtaccagtggcgtggtgaccagctgcaccggagtcctgccc
cagctcagcatggtcaagtacaactgtagcaagtgcaactttgtactggggcctttctgc
cagtctcagaatcaggaggtgaagcctggctcctgccctgagtgccagtctgctgggccc
tttgagatcaacatggaggagaccatctatcagaactaccaacgtatccgcatccaggag
agtcccggcaaggtggcggctggccgactgccccgttccaaggatgccattctcctcgct
gatctggtggacagctgcaagccaggggacgagatagagctgaccggcatttaccataat
aactatgacggctcgcttaacaccgccaacggctttccagtctttgccactattatcttg
gccaaccatgttgccaagaaggacaacaaagtagctgtgggggagctcaccgatgaggac
gtgaagatgatcaccggtctctccaaggatcagcaaattggagagaagatctttgccagc
attgcaccctccatctatgggcatgaagacatcaagagaggcctggctctggccctgttt
ggaggggagcccaagaacccaggtggaaagcacaaggttcgaggtgacattaatgtgctc
ttgtgtggggaccctggcacagcaaagtcccaattcctcaaatacatcgagaaagtgtct
agccgtgccatcttcaccactggccagggtgcgtcagcagtgggtctcaccgcgtacgtt
cagcggcatcccgtcagcagagagtggaccttagaggcgggagccctggttctggctgac
cggggggtgtgtctcattgacgagtttgacaagatgaatgaccaggacaggaccagcatc
cacgaggccatggaacagcaaagcatctccatctccaaggctggcatcgttacctcgctg
caagcccgctgcactgtcatagctgctgccaaccccataggaggccgctacgacccttca
ctgaccttctcagagaatgtagacctcacagagcccatcatttcccgctttgatgtcctg
tgtgtggtgagggacactgttgatccagttcaggatgagatgctggcccgctttgtggtt
ggcagccacgtcagacaccaccccagtaacaagaaggatgaagggttgactaatggtggc
accttggagccagccatgcccaacacatatggcgtggagcccctgcctcaggaggtgctg
aagaagtatatcatctatgccaaggagagggtccgcccgaagctcaaccagatggaccag
gataaagtggccaggatgtacagtgacctgaggaaggagtccatggcaacgggcagcatt
cccatcacggtgcgccacatcgagtccatgatccgcatggccgaggcccatgcccgcatg
cacctgcgggactacgtgatggaagacgatgtcaacatggccatccgagtgatgatggag
agcttcattgacacccagaagttcagcgtcatgcggagtatgcgcaagacttttgcccgg
tatctctccttccggcgagataacaatgatctgctgctcttcatactgaagcagttggtg
gctgagcaggtgacatatcaacgcaaccgctttggggcccagcaggacaccattgaaata
cctgagaaggatctgatggacaaggccaggcagatcaatattcacaacctctctgccttc
tacgacagcgacctcttcaaattcaacaagttcagccgtgacctgaaacgcaaactgatc
ctacagcagttctga

DBGET integrated database retrieval system