KEGG   Mus musculus (mouse): 17217Help
Entry
17217             CDS       T01002                                 

Gene name
Mcm4, 19G, AI325074, AU045576, Cdc21, Mcmd4, mKIAA4003, mcdc21
Definition
(RefSeq) minichromosome maintenance complex component 4
  KO
K02212  DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Module
mmu_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17217 (Mcm4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17217 (Mcm4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17217 (Mcm4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17217 (Mcm4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17217 (Mcm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM_N Mg_chelatase AAA_5 AAA_3 AAA Elf1
Motif
Other DBs
NCBI-GeneID: 17217
NCBI-ProteinID: NP_032591
MGI: 103199
Ensembl: ENSMUSG00000022673
UniProt: P49717 Q542F4 Q3UA65
Position
16 A2; 16 10.09 cM
AA seq 862 aa AA seqDB search
MSSPASTPSRRSSRRGRVTPTQSLRSEESRSSPNRRRRGEDSSTGELLPMPTSPGADLQS
PPAQNALFSSPPQMHSLAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSA
RKGLQVDLQSDGAAAEDIVPSEQSLGQKLVIWGTDVNVATCKENFQRFLQCFTDPLAKEE
ENVGIDITQPLYMQQLGEINITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAV
NEIFFDRYPDSILEHQIQVRPFNALKTKSMRNLNPEDIDQLITISGMVIRTSQLIPEMQE
AFFQCQVCAHTTRVEIDRGRIAEPCSCVHCHTTHSMALIHNRSFFSDKQMIKLQESPEDM
PAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHY
RKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGIL
LQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAV
GLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKA
GIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRR
LAHHLVSLYYQSEEQVEEEFLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVNMRKIG
SSRGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSATDPRTGIV
DISILTTGMSATSRKRKEELAEALRKLILSKGKTPALKYQQLFEDIRGQSDTAITKDMFE
EALRALADDDFLTVTGKTVRLL
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccccggcatccaccccgagccgccgcagcagccgacgcggacgagtcacccca
acccagtcccttcgaagtgaggaaagcaggtcgtcacccaatcggagacgtagaggcgaa
gattcttccaccggagagctactgccaatgcccacctcaccaggagccgacctgcagagc
ccacctgcacagaatgccttgttttccagccctcctcagatgcattctttagctattcct
ttggactttgatgttagttcaccattgacatatggcactcccagctcgcgagtggaagga
accccaagaagtggggtgagaggcacacctgtaaggcagaggccagatctgggctcagca
cgaaagggtttgcaggtggatctgcagtctgatggcgcagcagcagaagacatcgtacca
agtgaacagtctctaggccaaaagcttgtgatttggggaacagatgtgaatgtggcaaca
tgtaaagagaattttcagagattccttcagtgttttactgatcctctggccaaagaagaa
gaaaatgttggcatagatattactcaacctttgtacatgcaacaacttggagagattaat
attacaggagagccatttttaaatgtgaactgcgaacacataaaatcatttagcaaaaat
ctgtatagacagctcatctcctacccacaggaggttataccaacctttgacatggctgtc
aatgagatcttctttgaccgttatcctgactccatcttagaacatcagattcaagtcaga
ccttttaatgcgttgaagacaaagagtatgagaaacttgaatccagaagacattgatcag
ctcatcaccatcagtggcatggtcatcagaacatcacagctgattccggagatgcaggag
gcctttttccaatgccaagtctgtgcccacaccacccgggtggagatagatcgaggcaga
attgctgagccctgcagttgtgtgcactgccacactacccacagcatggcactgatccac
aaccgatcattcttctctgacaagcaaatgatcaaacttcaagagtctcctgaagacatg
cctgctgggcagacacctcacactattgtcctttttgcccacaatgaccttgttgacaag
gttcaaccaggggacagagtgaacgtcacaggcatatatcgagcagtaccaattcgagtt
aatccaagagtgagcaacgtgaagtctgtctataaaacccacattgatgtcattcattat
cggaaaacggatgcaaaacgtctgcatggccttgatgaagaagcagaacagaaacttttt
tcagagaaacgtgtgaaattgcttaaggaactttccaggaagccagatatttatgagcgg
cttgcttcagccttggctcccagcatttatgaacatgaagatatcaaaaagggaatctta
cttcagctctttggtggaacaaggaaggatttcagtcacactgggaggggtaaattccgt
gctgagatcaacatccttctgtgtggggaccctggcaccagcaagtcccagctgctacag
tatgtgtacaacctggtccccagaggccagtacacgtctggaaaaggctccagtgcggtc
ggcctcaccgcctatgtgatgaaagaccctgagaccaggcagcttgtcctccagacaggt
gccctcgtcctgagtgacaatgggatatgctgcatcgatgagtttgacaaaatgaatgaa
agcacaaggtctgtgctgcatgaggtcatggaacagcagactctgtccattgcaaaggct
gggatcatctgtcagctcaatgcgcgcacctctgtcctggcagcagcaaatcctattgag
tctcagtggaatcctaaaaaaacaaccattgaaaatatccaactaccgcacacattgttg
tcaaggtttgatctcattttcctcatgctagaccctcaggatgaggcatatgaccggcgt
ctagctcatcacctggtttcattgtactaccaaagtgaggagcaagtggaggaggagttc
ctggacatggccgtgctgaaagactacattgcatatgcccatagtaccatcatgccccga
ctgagtgaggaggccagccaggctctcattgaggcttatgtaaacatgaggaagattggg
agtagccgggggatggtttctgcttaccctcgacagctagagtcattaattcgcttagca
gaagcccatgctaaagtaagattttcaaacaaagttgaagcaattgatgtggaagaggca
aaacgcctccaccgggaggctctgaagcagtctgcaactgaccctcgtactggcattgtg
gatatttctattcttactacaggaatgagtgccacttctcgtaaacggaaagaagaatta
gctgaagcattgagaaaacttattttatctaagggtaaaacaccagccttaaagtaccaa
cagctgtttgaggatattcggggacagtctgacacagcaattaccaaggacatgtttgaa
gaagccctgcgagctttggctgatgatgatttcctaacagtgactgggaagactgtccgc
ctgctctga

DBGET integrated database retrieval system