KEGG   Mus musculus (mouse): 17218
Entry
17218             CDS       T01002                                 

Gene name
Mcm5, AA617332, AI324988, AL033333, Cdc46, Mcmd5, P1-CDC46
Definition
(RefSeq) minichromosome maintenance complex component 5
  KO
K02209  DNA replication licensing factor MCM5 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17218 (Mcm5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17218 (Mcm5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17218 (Mcm5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17218 (Mcm5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17218 (Mcm5)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17218 (Mcm5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     17218 (Mcm5)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat
Other DBs
NCBI-GeneID: 17218
NCBI-ProteinID: NP_001289469
MGI: 103197
Ensembl: ENSMUSG00000005410
Vega: OTTMUSG00000062027
UniProt: P49718 Q8BQ03
Position
8; 8 C1
AA seq 734 aa
MSGFDDPGIFYSDSFGGDPGAEEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVADEVTRPRPAGDEL
LQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLT
NIAMRPGLEGYALPRKCNMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLNPSKGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLH
VSALTQTQAVEGEIDLAKMKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGNLSGV
EGFTTQEDQEMLSRIEKQLKRRFAIGSQVSEHSIVQDFTKQKYPEHAIRKVLQLMLRRGE
IQHRMQRKVLYRLK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgtcgggcttcgacgacccgggcattttctacagcgacagcttcggtggcgaccccggt
gcggaagagggccaggcccgcaagtcgcaactgcagaggcgattcaaggagttcctgaga
cagtaccgagtgggcaccgatcgcacgggcttcaccttcaagtacagagatgaactcaag
cggcattacaacctgggtgaatactggatcgaggtggagatggaggacctggccagtttt
gacgaggaactggctgaccacttgcataaacagccggccgagcacttacagctgcttgag
gaagctgccaaggaggtggcagatgaggtgacccggccccggccagctggagatgagctg
ctccaagacatccaggtcatgctcaagtcagatgccagcccgtcgagcattcggattctg
aagtcagacatgatgtcacacctggtgaagatccctggcatcatcatttcagcctctgca
gtccgtgccaaggctactcgtatctccattcagtgccgcagctgccacaataccctcacc
aatatcgccatgcgcccaggcctagagggctatgcccttcccaggaagtgcaatatggat
caggctgggcgcccaaagtgcccactggatccatacttcatcatgcctgacaagtgcaag
tgtgtggacttccagactctgaaactgcaggagctgcctgatgcagtccctcatggtgag
atgcccaggcacatgcagctttattgtgacaggtacctgtgtgacaaggttgttcctggg
aacagggtcaccatcatgggcatttattccatcaagaagtttggcttgaaccccagcaag
ggccgggacagggtaggtgtgggcatccggagctcgtacatccgagtgctgggcatccag
gtggacacagatggctctggccgaagctttgctgggtctgtcagcccacaggaagaggag
gaatttcgtcgcctggctgccctccccaacatatatgagctcatctccaagagcatttcc
ccctccatctttgggggcatggatatgaagaaggccattgcctgcctgctttttgggggt
tcccggaagaggctcccagatggactcactcgccgaggtgatatcaacttgctgatgttg
ggagaccctggtacagccaagtctcagcttctgaagtttgtggagaagtgctctcccatt
ggggtgtacacatctgggaaaggtagcagtgctgctggcttgactgcctcagtgatacgg
gacccctcatctcgaaacttcatcatggaaggtggagccatggttctggccgatggtggg
gttgtctgtattgatgagtttgacaagatgcgggaagatgaccgtgttgcaatccatgag
gctatggagcagcagaccatctccattgctaaagctgggatcactaccaccttgaactct
cgctgctctgttctggctgcagccaactcagtgtttggccgatgggatgagacaaaaggg
gaggacaatattgacttcatgcctaccatcttgtcccgatttgatatgatcttcatcgtc
aaagatgagcacaatgaggagagggacatgatgctagccaaacatgtgatgactctgcat
gtgagtgcactgacacagacacaggctgtggagggtgagatcgacctggccaagatgaag
aagttcattgcctactgccgagcgaggtgtggacctcggctatcagcagaggcagcagag
aagctgaaaaaccgctacatcatcatgcggagtggggctcgtcagcatgagagggacagt
gaccggcgttccagcatccccatcactgtgcggcagctggaggctattgtgcgcattgct
gaggccctcagtaagatgaaactgcagccctttgccactgaggctgatgtagaggaggca
ttgagactgttccaggtgtccacactggatgctgctttgtctggcaatctgtcgggggtg
gagggcttcactacccaggaggaccaggagatgctgagccgcattgagaagcaactcaag
cgccgttttgccattggctctcaggtgtctgaacacagcattgtccaggacttcaccaaa
cagaaatatccagagcacgctatccgaaaggtgctgcagctcatgctacgcaggggtgag
atccaacaccgtatgcagcgcaaggtgctctatcgcctcaagtga

DBGET integrated database retrieval system