KEGG   Mus musculus (mouse): 17219
Entry
17219             CDS       T01002                                 

Gene name
Mcm6, ASP-l1, D1Wsu22, D1Wsu22e, Mcmd6
Definition
(RefSeq) minichromosome maintenance complex component 6
  KO
K02542  DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17219 (Mcm6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17219 (Mcm6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    17219 (Mcm6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     17219 (Mcm6)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    17219 (Mcm6)
SSDB
Motif
Pfam: MCM MCM_OB MCM6_C MCM_lid MCM_N Mg_chelatase AAA_3 AAA_5 Sigma54_activat
Other DBs
NCBI-GeneID: 17219
NCBI-ProteinID: NP_032593
MGI: 1298227
Ensembl: ENSMUSG00000026355
Vega: OTTMUSG00000049360
UniProt: P97311 Q542I2
Position
1 E3; 1 55.8 cM
AA seq 821 aa
MDLAAAAEPGAGSQHPEVRDEVAEKCQKLFLDFLEEFQGSDGEIKYLQFAEELIRPERNT
LVVSFADLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPFAKDFYVAFQDLPTR
HKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIKDVEQQFKYTQPNIC
RNPVCANRKRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGD
RCDFTGALIVVPDVSKLSTPGARAETNSRVSGADGYETEGIRGLRALGVRDLSYRLVFLA
CHVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHG
NDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVDEFSPRAVYTS
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDMRDQVAIHEAMEQQ
TISITKAGVKATLNARTSILAAANPVSGHYDRSKSLKQNINLSAPIMSRFDLFFILVDEC
NEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKR
LRQRDGSGVTKSSWRITVRQLESMIRLSESMARMHCCDEVQPKHVKEAFRLLNKSIIRVE
TPDVNLDQEEEIQMETDEGQGGVNGHADSPAPVNRFNGSSEDASQETVSKPSLRLGFAEY
CRISNLIVLHLRKMEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKTIIEKVVHRL
THYDHVLIELTQAGLKGSSEGSESYEEDPYLVVNPNYLLED
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggacctcgcagcggccgcggagcccggcgccggaagccagcacccggaggtgcgcgac
gaggtggccgagaaatgccagaagctgttcctagacttcctggaagagttccagggtagt
gatggagaaattaaatacttgcagtttgcagaggagctaattcgtcctgagagaaacacg
ctggttgtgagttttgcagacctggaacaatttaaccaacaactttctaccaccattcag
gaagagttctatagagtctacccttacctgtgtcgagccttgaagacctttgtcaaagac
cgaaaggagatcccttttgctaaggatttttatgttgcattccaagacctacctactaga
cacaagattcgtgagctcacttcatccaggattgggctgctcacccgaatcagtggccag
gtggtgcgcactcacccagttcaccctgagcttgtgagtggaactttcctgtgccttgac
tgtcaaacagtgattaaggacgtagagcagcagttcaaatacacacagccgaatatctgc
cgaaatccagtgtgtgccaacaggaagaggttccttctagacactaataaatcaagattt
gttgattttcaaaaggttcgcattcaagagactcaagcggaacttccccggggaagtatt
ccccggagtttagaggttatcctgagagctgaagctgtggagtcagcccaagctggtgac
agatgtgatttcacaggggcactgattgttgtgcctgatgtctccaagcttagcacacca
ggagcacgtgcagagactaactcccgagtcagtggagctgatgggtatgagacagaaggc
attcgagggctccgggcccttggtgtcagagatctgtcatacaggctggtcttccttgcc
tgccatgttgcaccaaccaacccaaggtttggagggaaagaactcagagatgaggaacag
accgctgagagcattaagaaccaaatgacggtgaaggaatgggaaaaggtgtttgaaatg
agtcaggacaaaaacctgtaccacaatctctgcacgagcctcttccctactatacatggc
aatgatgaagtaaaacgcggtgtcttactgatgttgttcggtggtgttcctaagacaaca
ggggaaggaacctctcttcgtggggatataaatgtttgcattgttggtgatccaagtaca
gctaagagccaatttctcaagcacgtggacgagttcagtcccagagctgtctataccagt
ggcaaagcctccagcgctgccggcttaacagcagctgtggtgagagatgaagaatctcac
gaatttgtcattgaggctggagcgttgatgctggctgataatggtgtctgttgtattgat
gaatttgataagatggacatgcgggaccaagttgctattcacgaagctatggagcagcag
accatctctatcacgaaagcaggagtgaaggcaactctgaatgccaggacatccatttta
gctgcagcaaaccctgtcagcggacactatgacagatcaaaatctttgaaacagaacatc
aatctgtcagcgcccatcatgtcccgctttgatctcttcttcattctggtggatgaatgc
aatgaggtgacagattatgctattgccaggcgcatagtagacttgcattcaagaattgaa
gaatcgatcgatcgagtttattcccttgatgatataagaaggtaccttctctttgcccga
cagtttaaacccaagatttccaaagagtcagaagacttcattgtggagcagtacaaacgt
ctccgccagagggatggctctggggtcaccaagtcctcgtggagaatcaccgtgcgacag
cttgagagcatgatccgactctcagaatcaatggcccgcatgcactgctgtgacgaggtt
cagcctaaacatgtgaaggaagcttttcgattactgaataaatcaatcatccgtgtagag
acgcctgatgtcaatctagatcaagaggaagagatccagatggagacggatgagggacaa
ggaggcgtcaatggtcatgccgacagccctgcccctgtgaataggttcaacggctccagt
gaagatgccagccaggagactgtttccaagccctccctgaggctgggctttgctgaatac
tgccgaatctcgaacctcatcgtgctccacctcaggaaaatggaagaagaggaggacgag
tcggcactaaagagaagcgagcttgtcaactggtacctgaaggaaatcgaatcagagata
gactctgaagaagagctcataaataaaaagacgatcattgagaaggttgttcatcgtctc
acacactacgatcacgttctgattgagctcacccaggctgggctgaaaggctccagtgaa
ggaagcgagagctatgaggaagacccctacctggtagtcaaccctaactacttgcttgaa
gattga

DBGET integrated database retrieval system