KEGG   Mus musculus (mouse): 17221
Entry
17221             CDS       T01002                                 

Gene name
Cd46, Mc, Mcp
Definition
(RefSeq) CD46 antigen, complement regulatory protein
  KO
K04007  membrane cofactor protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    17221 (Cd46)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    17221 (Cd46)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17221 (Cd46)
   04090 CD molecules [BR:mmu04090]
    17221 (Cd46)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   17221 (Cd46)
CD molecules [BR:mmu04090]
 Proteins
  17221 (Cd46)
SSDB
Motif
Pfam: Sushi PRIMA1
Other DBs
NCBI-GeneID: 17221
NCBI-ProteinID: NP_034908
MGI: 1203290
Ensembl: ENSMUSG00000016493
Vega: OTTMUSG00000034956
UniProt: O88174
Position
1 H6; 1 98.41 cM
AA seq 365 aa
MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTP
KLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKV
YYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIK
NGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCP
NPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRP
THPTKPPVYNYTGYPSPREGIFSQELDAWIIALIVITSIVGVFILCLIVLRCFEHRKKTN
VSAAR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgacggcggcgcctcttatgccagactcaacgcacccctgtcgcagaaggaagagctac
actttcttctggtgctccttgggcgtctatgctgaggcccttctgtttctgctgtctcat
ttatctgatgcctgtgaactaccacggccatttgaagctatggaactcaagggtacacct
aaactcttttatgccgttggagagaaaatagaatataagtgtaaaaaaggatacctgtat
ctgtctccatacctgatgattgctacctgtgagccaaatcatacatgggtccctatttca
gatgctggttgtattaaagttcaatgtactatgttacaagacccttcatttggcaaagta
tactacatagatggcagcttttcatggggtgctcgagctaaatttacttgtatggaaggt
tattacgtagttggtatgtcagttctacactgtgtgcttaaaggtgatgatgaagcatac
tggaatggctatcccccacattgtgaaaagatttattgtttaccacctccaaaaataaaa
aatggaacacatacccttactgatataaatgtattcaaataccatgaagcagtaagttac
agttgtgatcctaccccagggccagataagttttcccttgttggaacaagcatgatattc
tgtgctggccataacacctggagtaacagccctccggagtgtaaagtggtaaaatgtcca
aatccagtactacaaaatggaagactgatatcaggagctggcgaaatattttcctatcaa
tcaacagtgatgtttgagtgtttgcaaggattttacatggaaggcagtagcatggtgatc
tgtagtgctaataactcttgggagccatctatcccaaaatgtcttaaaggtcctaggcct
actcatcctaccaagcctccagtttataattatacaggatatcctagtccccgtgaagga
atatttagccaagaattagatgcatggattattgctttgattgttattacgtcaattgtt
ggagtttttatactttgtctcattgtgctcaggtgttttgagcacaggaagaaaacaaat
gtatctgcagcaagatga

DBGET integrated database retrieval system