KEGG   Mus musculus (mouse): 17222
Entry
17222             CDS       T01002                                 

Gene name
Anapc1, 2610021O03Rik, AI047775, AI853536, AW547281, Ap, Apc1, Mc, Mcpr, tsg2, tsg24
Definition
(RefSeq) anaphase promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    17222 (Anapc1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17222 (Anapc1)
   04114 Oocyte meiosis
    17222 (Anapc1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17222 (Anapc1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17222 (Anapc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    17222 (Anapc1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17222 (Anapc1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     17222 (Anapc1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    17222 (Anapc1)
SSDB
Motif
Pfam: Apc1_N APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 17222
NCBI-ProteinID: NP_032595
MGI: 103097
Ensembl: ENSMUSG00000014355
Vega: OTTMUSG00000015352
UniProt: P53995
Position
2; 2 F1
AA seq 1944 aa
MSNFSEERATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGDAADYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
STVQQALWCDFIISQDKSEKIYKSHELEKCICILQSSCMNMHSIDGKDYIASLPFQVANV
WATKYGLLFERCSSSHEVPPSLPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DPAVKIVFLNIDPSIVMTYDAVQNVHSVWTLRRVKPEEENAVLKFPEQAGTLQNATTSSS
LTAHLRSLSKGESPVASPFQNYSSIHSQSRSTSSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGAQRFNLSSHSQSPKRHSISHSPSGSFNDSFLAPETEPIVPELCIDHLWTETLPNI
REKNSQASKVFITTDLCGQKFLCFLVEAQLQLRCVKFQESNDKTQLIFGSVTNIHAKDAA
PVEKIHTMLVLEGNGNLVLYTGVVRVGKVFIPGLPAPSLTMSNMMPRPSTPLDGVGTPKP
LSKLLGSMDEVVLLSPVPELRDSSKLNDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELS
NGSMVRITIPEVATSELVQTCLQAIKFILPKEVAIQVLVKWYNVHSAPGGPSCHSEWSLF
VICLLNMMGYNTDRLAWTRSFDFEGSLSPVIAPKKARPSDTGSDEDWEYLLNSEYHRNVE
SHLLNKSLCLTALEVSNAKDEDFSQNLSLDSSTLLFAHIPAIFFVLHLVYEELKLNTLMG
EGICSLIDLLVQLARDLKLDSYLDHYYRDSPTLVKTTGQVCTIDQGQMGFMHHPPFFTSE
PPSIYQWVSSCLKGEGMPPYPYLPGICERSRLVVLSIALYTLGDESCVSDETCQYLSKVT
STPQKPQAEQEENRFTFRHSASVSVLAERLVVWMASVGFTLRDLETLPFGIALPIRDAIY
HCREQPDSDWSEAVCLLIGRQDLSKQACEGNLPRGKSVLSSEVSSGTEAEEEDDGMNDLN
HEVMSLIWSEDLRVQDVRRLLQSAQPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPVPKLNLTGRAPPRNTTVDLNSGNIDVPPNMASWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHVPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQTGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFSCLHKFAKDFMNYLS
APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTNTPCYALIEVTYKGTQWYEQTKEELMAPTLLPELHLLKQMKVKGPRYWELLIDL
SKGEQHLRSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISS
FTSDPALLSFAEYFCKPTVSMGPKQEILDLFSSILYECVAQETPEMLPAYIAMDQALRSL
KKRDMSDTSDLWQIKLILEFFSSRSHQDRQHTYPKRGLFINSEFLPVVKCTVDATLDQWL
QAGGDVCVHAYLSGQPVEKSQLNMLACFLVYHSVPAPRHLPPMGLEGSTSFAELLYRFRH
LKMPVRALLRLAPVLLGNPQPMVM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacttctctgaagaaagggcaacgatgattgcagccggggatttgcaggaattt
gttccttttggccgagaccactgcaagcaccaccctaacgctctgaaccttcagcttcgt
cagctgcagccagcctctgagttatggtcttctgatggtgcagctggcttggtgggatct
cttcaggaggttacaatccatgagaaacagaaggaaagctggcagttaagaaaaggtgtg
agtgagattggagatgcagctgactacgatgaagagctctatgtggctgggaacatggtt
atctggagcaaagggagtaaaagccaggcactggcagtgtacaaagcgttcacagtggac
agcactgtccagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
atctataagagccatgaactagagaaatgcatatgtatattacagagttcatgtatgaac
atgcatagcatagacgggaaggattatatagcttccttaccttttcaggtggcaaatgtt
tgggccactaaatatggcttgctgtttgaacgatgcagttcttcacatgaggtacctcca
agtctacctagagaacctttgcctactatgttcagcatgctgcacccactggatgagata
actccacttgtttgtaaatccggaagtctttttggctcatcacgggtacagtatgttgta
gatccagcagtgaaaattgtgtttctgaacattgacccctccattgtcatgacctatgat
gctgttcagaatgtgcattctgtgtggactctgcggagggtaaagccagaggaagagaat
gctgttttaaagttccctgagcaggcagggaccctgcagaatgcaactactagcagctcc
ctgacagcacatctcagaagcctctccaaaggcgaatcccctgtggcttcgccgttccag
aattactcttccattcacagccagagtcgctcaacctcttcgcccagtctacactctcgg
tcgccttccatttccaacatggcggctctaagtcgtgctcactctcctgccttaggtgtg
cactctttctcaggggcgcaaagattcaacctttcaagccacagtcagtcaccaaagaga
cacagcatttctcactctccgagtggcagtttcaacgactcatttttggcaccagaaaca
gagccaattgttcctgagctgtgcattgatcacttatggactgagacacttccgaatata
agagagaaaaattctcaagcctccaaggtatttataacgactgacctgtgtggacagaag
ttcttgtgctttttagtggaggcccagcttcagttacgctgtgtaaagtttcaagagagt
aatgacaagactcagcttatctttggctctgtcaccaacatacatgcaaaagatgcagcc
ccagtggagaagatacacaccatgctggtcctagaaggcaacgggaacctggtgctgtac
acaggagtggtgcgggtggggaaagtctttatccctggacttccggctccttccctgaca
atgtccaacatgatgcctcggcccagtaccccgctcgacggtgttggtactccaaagcct
ctgagtaaattgcttggatcgatggatgaggtggttctgttgtctccagttccagaattg
agggattcttcaaaacttaatgattctctctacaatgaggattgcacattccagcagctt
ggaacttacattcattctgtgcgagaccctgttcataacagagtcactctagaactgagc
aatggctccatggttcggatcactatccctgaagtggccacctcggaattagtacaaacg
tgtctgcaagcaattaagttcatcctgccaaaagaagtagccattcaggtgctcgtcaag
tggtacaatgtgcacagtgctccaggaggacccagctgtcactcagagtggagtttattt
gtgatttgtctcttgaacatgatgggttataacacagaccgcttagcatggacccgaagt
tttgactttgaaggatcactttccccagtcattgcacccaaaaaagcaaggccttctgat
actggatctgacgaggactgggagtacttactgaactcagagtaccatcgcaatgttgag
tctcatcttttgaacaaatctctatgtttgactgctttggaagtttcaaatgcaaaggat
gaagatttttcgcagaacctcagtctggattcttctacccttctctttgctcacattcct
gcaattttctttgttcttcacctggtttatgaagagctcaagttgaatactctaatggga
gaaggaatttgttctcttatcgacctccttgttcagttggcaagggacttaaaattggac
tcttacttggaccattactatcgagattccccaactcttgtcaaaaccactggacaagta
tgcaccattgaccaaggtcagatgggatttatgcatcatcccccattttttacttctgag
ccaccaagtatttatcagtgggtgagttcatgcctgaagggtgaagggatgccaccctat
ccttaccttcctgggatttgcgagaggagcaggctagtggtcttgagcattgccctctat
acccttggtgatgagagctgtgtgtctgatgaaacttgccagtacttatccaaagtaacc
tcaactccccaaaagccacaagcagagcaagaagaaaacaggtttactttccggcattct
gcttccgtttctgttctggccgagagattagttgtctggatggccagtgtaggattcact
ttaagagatctggagactcttccctttgggattgctcttcccatcagagatgcgatttac
cactgtcgggagcagcctgattcagattggtcagaagcggtctgtctcttgattggacgt
caggatctttccaagcaggcttgtgaaggaaatttacccagaggcaaatctgtgctctca
tcagaggtgtcttcaggaactgaggcagaggaggaagatgatggcatgaatgacttgaac
catgaggttatgtcattaatatggagtgaagatttacgggtgcaggatgtgcgaaggctg
cttcaaagtgcacagcctgtccgtgtcaatgtggtgcagtacccagaactcagtgaccat
gagttcattgaagaaaaggaaaacagactgctccagttgtgtcagcgaactatggccctt
ccagtaggacgaggaatgtttaccttgttctcatatcatcctgttccaacagagccgttg
cctgttcctaaattgaatctgacagggcgagcccctccacgaaacacaactgtagatctt
aatagcggaaacatcgacgtgcctcccaacatggccagctgggccagctttcataatggt
gtggctgccggcctgaagatagccccagcctcccagatagactcagcttggatcgtttac
aacaagccaaagcatgctgagttagccaatgagtatgccggctttctcatggccctgggt
ctgaatgggcaccttaccaagctggctactctcaatatccatgactatttgaccaagggc
catgaaatgacaagcattggattgctacttggtgtttctgctgcaaagcttggcaccatg
gacatgtcaattacccggctcctcagcattcacgttcctgctctcttacccccgacatcc
acagagcttgacgtgcctcacaatgtccaagtggcggctgtggttggcattggccttgtg
tatcagggcacagctcacagacacactgcggaagtcctgttggctgaaatagggcggccc
cctggtccagaaatggaatactgcactgacagagagtcgtactccttagctgctggcctg
gccctgggcatggtttgcttggggcatggcagcaatttgattggcatgtctgatctcaat
gtgcctgagcagctgtatcagtacatggttggaggccataggcgatttcaaactggaatg
cacagggagaaacataagtctccaagttatcagatcaaagaaggagacaccataaacgtg
gatgtgacttgtcccggtgctactctggcgttggctatgatctacttaaaaaccaataac
aggtccattgctgattggctgcgtgctcctgataccatgtatttgctagactttgtgaaa
ccagaattccttttgcttaggacacttgctcggtgcttgattttgtgggatgatatctta
ccaaattccaagtgggttgacagcaatgttcctcagattataagagaaaatagtatctct
ctgagtgaaattgaattgccttgttcagaggacttgaatttggaaaccttgtcgcaagca
cacgtctacatcattgcaggagcctgcttgtctctagggtttcgatttgctggctcagaa
aacttatcagcatttagctgtctgcataaatttgcaaaagattttatgaattatttatct
gcacccaatgcttctgtaacagggccctataacctcgaaacctgcctgagtgtggtcctg
ctgtctcttgccatggtgatggctggctctgggaacctgaaggtgttgcagctctgtcgc
tttctgcacatgaagactggtggagagatgaactatggcttccacttggcccaccacatg
gccctgggccttctctttttgggaggaggaaggtactctttgagcacatccaactcatcc
attgctgcccttctctgcgccctttacccacatttcccagcccacagcactgacaaccgg
tatcatctccaggcccttcggcacctctatgtgctagctgcagaaccaaggctcctggta
cctgtggatgtggatacaaacacaccctgctatgcccttatagaagttacttacaagggc
actcagtggtatgaacagaccaaagaagaactgatggctccaacccttcttccagaactt
catcttttaaagcagatgaaagttaaagggccaagatactgggaactgctcatagattta
agcaagggagaacagcacttgaggtctattctttcgaaggatggagttttatatgtaaag
ctcagggcaggacagctctcctacaaagaagacccaatggggtggcagagtttgttggca
caaactgttgctaataggaactctgaagcccgggctttcaagcctgaaacaatttcatca
ttcacttctgatccagcacttctgtcatttgctgaatatttctgcaagccgactgtgagc
atgggtccaaaacaggagattctggacctcttttcttcgatactttatgagtgtgttgct
caggaaaccccagagatgttgcctgcctacatagcaatggatcaggctctaagaagtctt
aaaaagagagacatgtcagacacatctgatctttggcagataaagttgatattagaattt
ttcagttcccgaagccaccaggataggcagcatacctatcctaagcgagggctcttcata
aattctgagttcctacctgtggtgaagtgcactgttgatgctaccctggaccagtggcta
caagctggcggtgatgtgtgtgtgcatgcctacctcagtgggcagcctgttgagaagtct
cagctaaacatgctggcctgcttccttgtctaccactctgtgccagcaccacgacacttg
ccccccatgggactggaagggagcacaagctttgctgaactcctctacaggttccgacac
ctgaagatgcccgtccgggctttgctaagactggctcctgtgctgcttgggaacccacag
ccgatggtcatgtga

KEGG   Mus musculus (mouse): 217232
Entry
217232            CDS       T01002                                 

Gene name
Cdc27, AI452358, AP, APC3, BC023187
Definition
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    217232 (Cdc27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    217232 (Cdc27)
   04114 Oocyte meiosis
    217232 (Cdc27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    217232 (Cdc27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    217232 (Cdc27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    217232 (Cdc27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    217232 (Cdc27)
   03036 Chromosome and associated proteins [BR:mmu03036]
    217232 (Cdc27)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     217232 (Cdc27)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     217232 (Cdc27)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    217232 (Cdc27)
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_16 TPR_17 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs PPTA TPR_MalT TPR_20 Cas_Cas02710 DUF2225
Other DBs
NCBI-GeneID: 217232
NCBI-ProteinID: NP_663411
MGI: 102685
Ensembl: ENSMUSG00000020687
Vega: OTTMUSG00000003148
UniProt: A2A6Q5 Q3TTW1 Q8BYJ1
Position
11 E1; 11 67.79 cM
AA seq 825 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDLVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSTVI
SPDNVPLGPGTAILSKQVQNKPKTGRSLLGGPTALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVAPTGAPTKKSVARMGQTGTKSVFSQSGNSREVTPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGLT
QPSINDSLEITKLDSSIISEGKITTVTPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYSTGWVLCQIGRAYFELSEYMQAERIFSEVRRIESFRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcgctaaaccactatgct
taccgagatgcagttttcctcgcagaacgactatatgcagaagtacattcagaagaagcc
ttgtttttactggcaacctgttactaccgctcaggaaaggcttataaagcatatagactc
ttgaaaggacacagttgtaccaccccacagtgtaaatacctgcttgcaaaatgttgtgtt
gacctcagcaagcttgcagaaggggaacagatcttatctggtggagtgtttaataagcag
aaaagccatgacgaccttgtcactgagtttggagattcagcttgcttcactctttccttg
ttgggacatgtgtattgcaagacagatcggcttgccaaagggtcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcgttatgtgaaataggtgag
aagccagatcctgaccaaacatttaaattaacatctctacagaattttagcagttgtctt
cccaacacttgtacaactctagtatctaatcacagtttatctcacagacagcctgagaca
gtccttacagaaacaccccaagacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtactccttgaatacagattcctccgtgtcttacattgattcaactgtaatt
tcaccagataacgtcccccttggacctggtactgccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttattaggaggaccaactgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacaccttctgtaattgatgtggcacccaccggagcacctacaaaaaagtct
gttgcaagaatgggccaaactggaacaaagtctgtcttctcacagagtggaaatagtcga
gaggtcacaccagtacttgttgcacaaacacaaagttctggcccacaaacaagtacaaca
cctcaggtattgagccccactatcacatctcccccaaacgcattgcctcggagaagttcc
cgccttttcactagtgacagttctacaaccaaggagaatagcaaaaagttaaaaatgaag
tttccacctaaaatccctaacagaaaaacaaaaagtaaaactaataaaggaggactaact
cagcccagcataaacgatagtctggaaattacaaaactggactcctctatcatttcagaa
gggaaaataaccacagtcacacctcagatccaggcatttaacctacaaaaggcagcagca
gaaggtttgatgagccttcttcgtgaaatgggaaaaggttatttagctttgtgttcatac
aactgcaaagaagctatcaatattttgagccatctaccttctcatcactacagtactggt
tgggtcctatgccagattggacgggcttattttgaactttcagaatacatgcaggctgaa
agaatattctcagaggttagaaggattgagagtttcagagttgaaggaatggagatctac
tctacaacactctggcatcttcagaaagacgttgctctttcagttctttcaaaagattta
acagacatggataagaattcaccagaggcctggtgtgctgcagggaattgtttcagtcta
caacgagagcatgatatagcaattaaattcttccaaagagctatccaggtcgatccaaat
tacgcttacgcctatactctattaggacatgagtttgtgttaactgaagaactagataaa
gcattagcatgttttcgaaatgctataagagtaaatcccagacattacaatgcatggtat
ggtttaggaatgatttattacaagcaagagaagttcagcctcgcagaaatgcatttccag
aaagcacttgatatcaaccctcagagttcagttttactttgccacattggagtagttcag
catgcactaaagaagtctgagaaggctttggataccctaaacaaagccattgttatcgat
cccaagaaccctctatgcaaatttcacagagcctcggttttatttgcaaatgaaaaatac
aagtctgctttacaagaactcgaggaactgaagcagattgtccccaaagagtccctcgtt
tacttcctaataggaaaggtttacaagaagttgggtcaaactcatctcgccttgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataatcagattaaagaggcaatt
gacaagcgctaccttccagatgatgaggagccaataacccaggaggaacagatcatgggg
acagatgaatcccaggagagcagcatgacagatgcagatgacacacaacttcatgcggcg
gaaagtgacgaattttaa

KEGG   Mus musculus (mouse): 52206
Entry
52206             CDS       T01002                                 

Gene name
Anapc4, 2610306D21Rik, AP, APC4, D5Ertd249, D5Ertd249e
Definition
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    52206 (Anapc4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    52206 (Anapc4)
   04114 Oocyte meiosis
    52206 (Anapc4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    52206 (Anapc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    52206 (Anapc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    52206 (Anapc4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52206 (Anapc4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     52206 (Anapc4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    52206 (Anapc4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 52206
NCBI-ProteinID: NP_077175
MGI: 1098673
Ensembl: ENSMUSG00000029176
Vega: OTTMUSG00000023353
UniProt: Q91W96 Q3TM92
Position
5 C1; 5 28.81 cM
AA seq 807 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLAWSPKRDLIALANTTGEVLLHRLASFHRVWSFPP
NESTGKEVTCLAWRPDGKLLAFALADTKKIILCDVEKPESLHSFSVEAPVSCMHWTEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYNSTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCIALCLSSDLKSLSVVTEVSSGGESEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKPTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSTHLKESPLLFPYYPRKSLHFVKRRMENVIDQCLQKP
ADVIGRSMNQAICIPLYKDARSMDCARRLLKFPFLWNNKTSNLHYLLFTILEDSVYKMCI
LRRHTDISQSVSNGLIGIKFGSFTSASADKVRRSSYSCLDAQFYDDETVTVILKDSMGRE
GRDRILVQLSLSLVYNSEDSDEYEFTGSYSTRLDEQGSIIPTRTMHFEKHWRLLESMRAQ
YVAGNGLRKVSCVLSSNLRHVRVFEMDIDDEWEIDESSDDEEEAGGKPVKIKEEVLSESE
TEAHQDAAALDPDVVIKVEKLDPELDS
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgctgcgctttccgacctgtttcccatcctttcgggtggtgggagagaagcagctgcca
caggagattattttcttggcctggtcccccaagcgagacctcattgctttggccaacact
acaggcgaggttttgctgcatcgccttgcaagttttcatcgagtttggagtttcccacca
aatgaaagtacaggaaaagaagtgacctgcttggcctggagaccagacggcaaacttttg
gcctttgctcttgcggataccaagaaaattattttgtgtgatgtagaaaagcctgaaagc
ttacactccttctctgtggaggctccggtctcttgtatgcattggacagaagtgactgtg
gaaagcagtgttttaacatcgttttataatgctgaggatgagtccaatcttctcttgcct
aagctgcccacattgccaaaaaattacaacagcacctcaaaaatatttagtgaagaaaat
tctgatgaaattatcaagctcttgggagatgtcaggctgaacatccttgtccttggagga
agctctggatttattgagctttatgcttatgggatgttcaaaattgcccgagtaacaggg
attgccggaacttgtattgctctgtgtttatcaagtgatttgaagtcattatcagtggtc
acagaggtttccagcggtggcgaatcagaagtttcatattttcagcttgaaaccaatctg
ctgtattccttcttacctgaagtaactcgtatggccaggaagtttactcacatttcagct
ctcttacagtatataaatttgtcactgacatgtatgtgtgaagcatgggaagaaattctg
atgcagatggactcccgtcttaccaagtttgtacaggaaaaacctacaaccacgtcagtg
caggatgagttcatgcacttgctgctgtgggggaaagccagtgctgaacttcagactctc
ctgatgaaccagttaacagtgaagggcttaaaaaagcttggccagtctatagagtcatca
tattccagtatacaaaaactggttataagtcacttacagagtggctctgagtctttactg
tatcatttgagtgaacttaaaggaatggcttcatggaaacaaaaatacgaacctctagga
ctggatgctgcaggcattgaagatgctattactgctgtgggttctttcatcctcaaagca
aacgaacttctccaagttatagacagtagtatgaaaaacttcaaggcattttttcggtgg
ctgtatgtagcaatgctgagaatgacagaggaccatgtgcttcctgagctgaacaagatg
actcagaaggatatcacatttgttgctgaattcctcactgaacatttcaatgaggctcca
gacctttataataggaaaggaaaatacttcaatgttgaaagagttggtcagtatttgaaa
gatgaagacgacgaccttgtgtcaccccctaacacagaaggaaaccagtggtatgacttc
ctccaaaacagcacccacctgaaagaaagtcctttgctgtttccttattaccctcgaaaa
tcattgcattttgtgaaaaggcggatggagaacgttattgatcagtgtttgcaaaagcca
gcagatgtaattggaagatcgatgaatcaagcaatttgcattccattatataaagatgct
aggagtatggactgtgcacgaagattgttaaaattcccatttctgtggaataataaaact
tcgaatcttcattatcttctttttactattttagaagattcggtttataaaatgtgcatc
ttaaggagacatactgatatttcccaatctgtaagtaatggactaattggtattaaattt
gggagcttcacatctgcctcagctgacaaggtcagaagaagctcttacagttgtctagac
gcccagttctatgatgatgagactgtcacggtcatcctgaaggactccatgggacgtgaa
gggagagacaggattttggttcagttgtcactgtccttggtgtataacagtgaagattct
gacgaatatgagttcactgggagttactcgacaaggcttgacgagcagggcagcattatc
cccacacgcaccatgcactttgagaaacactggaggctgctagaaagcatgagagcgcag
tatgttgctgggaacggccttcgaaaagtgtcctgtgtgttaagttcaaacctccggcat
gtgagggtgtttgaaatggacatcgatgatgagtgggagattgacgagtcttcagacgat
gaggaggaggctggcgggaagcctgtgaagatcaaggaggaagtgttgtcagagtcagag
acagaggctcaccaagacgctgctgccctagacccggacgtagtcatcaaagtggagaaa
cttgaccctgagttggactcgtga

KEGG   Mus musculus (mouse): 52563
Entry
52563             CDS       T01002                                 

Gene name
Cdc23, 6030435O18, D18Ertd243, D18Ertd243e
Definition
(RefSeq) CDC23 cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    52563 (Cdc23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    52563 (Cdc23)
   04114 Oocyte meiosis
    52563 (Cdc23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    52563 (Cdc23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    52563 (Cdc23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    52563 (Cdc23)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52563 (Cdc23)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     52563 (Cdc23)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    52563 (Cdc23)
SSDB
Motif
Pfam: TPR_1 ANAPC8 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 TPR_17 ANAPC3 TPR_12 DUF772 TPR_9 TPR_15
Other DBs
NCBI-GeneID: 52563
NCBI-ProteinID: NP_848124
MGI: 1098815
Ensembl: ENSMUSG00000024370
Vega: OTTMUSG00000033488
UniProt: Q8BGZ4 A0A0R4J1W7
Position
18 B1; 18 18.69 cM
AA seq 597 aa
MAANSSVVSVAAAATAVPGVSTVADFSDLQEIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLSELQPPPPLTEEDAQDVDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSRKHQARGLDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTSDTPGTFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgaattcttcggtagtctcggtggcagcggccgccacggcggtgccgggcgta
tccactgtcgcggatttttcagacttgcaggaaattaaaaagcagctgctgctcatcgcg
ggcctcactcgggagcggggcctgctgcatagcagcaaatggtctgcggagttggccttc
tctctgcccgccttgcctttgtcggagctgcagccgccgccgcctctgacagaggaggac
gcgcaggatgtggatgcttacaccctggccaaggcctactttgatgttaaagagtatgac
cgggcggcacatttccttcacggctgcaatagcaagaaagcctatttcctgtacatgtat
tccagatacctgtctggagagaagaagaaggatgacgaaacagttgatagcctaggaccc
ctagagaagggacaagtcaaaaacgaggctctcagagaactgagagtggaactcagccgg
aagcaccaggctcggggacttgatggattcggcctttacctgtatggggtggtgcttcgg
aaactggacttagtgaaagaggccattgatgtgtttgtggaggctactcatgttttgcct
ttgcactggggagcctggttagagctgtgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgcctgacacctggatgaaagagttcttcttggctcacatatacacagaa
ctgcagctgatagaggaggccctgcagaagtatcagcatctcattgatgtgggcttttcc
aagagctcgtacattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctttctattttcaatgagctgaggaaacaagatccttacaggattgaaaatatg
gacacattctccaaccttctctatgtcaggagcatgaagtctgaattgagttacctggcg
cataacctctgtgaaattgataaataccgagtagaaacatgctgtgtaattggcaattat
tacagcttacgctcccagcatgagaaagcagctttgtatttccagagagccctaaagttg
aatcctaggtaccttggggcctggacactgatggggcacgagtacatggagatgaagaac
acgtctgcagctattcaggcttaccgacatgccattgaggtcaacaagagagactacaga
gcttggtatggccttgggcagacttacgaaatccttaaaatgccattttattgcctttat
tattatagacgggcccaccagcttcgtcccaatgattctcgcatgctggttgccttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcatat
gccgtgggagacgtggagaaaatggctcttgtgaagctggccaagcttcatgaacagttg
actgagtcagagcaggctgcccagtgttacatcaaatacatccaagatatctattcctgt
ggggagaccgtggagcacttggaggagagcacagccttccgatacctggcccagtactat
tttaagtgcaagctgtgggatgaagcttcaacttgtgcccaaaaatgttgtgcattcaat
gatacccgggaagaaggtaaggccttgctccgccagatcctacagctgaggaaccaaggg
gagacacccacctctgacacgccgggtacctttttcctccctgcctcactgtctgcaaac
aacactcctacacgcagagtttctccactcaacctgtcttcagtcacaccatag

KEGG   Mus musculus (mouse): 56317
Entry
56317             CDS       T01002                                 

Gene name
Anapc7, AP, APC7, AW545589
Definition
(RefSeq) anaphase promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    56317 (Anapc7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    56317 (Anapc7)
   04114 Oocyte meiosis
    56317 (Anapc7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    56317 (Anapc7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    56317 (Anapc7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56317 (Anapc7)
   03036 Chromosome and associated proteins [BR:mmu03036]
    56317 (Anapc7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     56317 (Anapc7)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    56317 (Anapc7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_16 TPR_1 TPR_14 TPR_19 ANAPC3 TPR_17 TPR_11 TPR_7 TPR_21 TPR_12 TPR_10 BTAD
Other DBs
NCBI-GeneID: 56317
NCBI-ProteinID: NP_062779
MGI: 1929711
Ensembl: ENSMUSG00000029466
Vega: OTTMUSG00000026723
UniProt: Q9WVM3
Position
5; 5 F
AA seq 565 aa
MSVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPELFSPSQKYQLLVYHADSLFHDKEYR
NAVSKYAMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKYKMAECYTMLKLDKD
AIAVLDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLLSLSV
KGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAINTICSLEKKSLLRDNVDLL
GSLADLYFRAGDSKNSVLKFEQAQMLDPYLIRGMDVYGYLLAREGRLEDVENLGCRLFNI
SDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAII
HFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGANAQTLTLLATVCLED
PVTQEKAKTLLDKALAQRPDYVKAVVKKAELLSREQKYEDGIALLRNALANQSDCVLHRI
LGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSG
EEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgagtgtgatagaccacgtgcgggacatggcggctgcgggactgcactccaacgtgcgg
ctcctcagcagcctgctgctcaccatgagtaacaacaaccctgagctgttttccccgtcg
cagaagtaccagctcttggtgtatcatgcagactctctgtttcacgataaggagtaccgc
aatgctgtgagtaagtacgccatggctttacagcagaagaaagccttaagtaagacttcc
aaagtgcggccttccactgggaattctgcatctactccacagagtcagtgtcttccatct
gaaattgaagtgaaatacaaaatggctgagtgttacacaatgctgaagctagacaaggat
gccattgctgtactcgatgggatcccttcaagacaaagaactcccaaaataaacatgatg
ctggcaaacctgtacaagaaggctggtcaggagcgcccatcagtcacaagctataaggag
gtcctgcggcagtgccctttggcccttgacgccattctaggtttgttatccctgtctgtg
aaaggcgcagaggtggcatcaatgacgatgaatgtgatccagactgtgcccaacttggac
tggctgtccgtgtggattaaagcgtatgcttttgtgcacaccggtgacaactcgagagca
atcaacaccatctgttcactagagaaaaaatcattactgcgagacaacgtggacctgctg
gggagcctggccgacctgtacttcagagcaggggacagcaagaactctgtcctcaagttt
gagcaggcccagatgctggatccctacttgataagagggatggatgtttacggctacctc
ctggcacgagaagggcggctggaggatgtggagaaccttggctgccgcctcttcaacatt
tctgatcagcatgcagagccctgggtggtctccggatgccacagcttctatagcaagcgc
tactctcgggccctgtacttaggtgccaaggccatccagctgaacagcaacagcgtccag
gctctgttactcaagggggcggcgcttaggaacatggggagggtccaggaagccatcata
cactttcgggaggccatcaggcttgcgccttgtcgcttggactgttacgaaggtctcata
gagtgttacttagcttctaacagcatccgagaagcaatggtgatggccaacaatgtttac
aaaactctgggtgcaaacgctcagacgcttacgctgttagccaccgtgtgtctggaagat
ccagtgacccaggagaaagccaaaactctgttagataaagccctggcgcagaggccggac
tacgtcaaggccgtggtgaagaaagcagagctgctcagcagggaacagaaatatgaagat
ggaattgctctgctgagaaatgcgctggccaaccagagtgactgtgtcctgcatcggatc
ctgggggacttcctagtagctgtgaacgagtaccaggaagcgatggaccagtacagtata
gcactgagtttggaccccaatgaccagaagtctctcgaggggatgcagaagatggagaag
gaggagagtcccacggatgccactcaggaggaagatgtggacgacatggaggggagtggg
gaagaaggggacctggagggcagcgacagtgaggcagcccagtgggcagaccaggagcag
tggttcggcatgcagtga

KEGG   Mus musculus (mouse): 59008
Entry
59008             CDS       T01002                                 

Gene name
Anapc5, 2510006G12Rik, AA408751, AA536819, AA986414, APC5, Anpc5
Definition
(RefSeq) anaphase-promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04657  IL-17 signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    59008 (Anapc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    59008 (Anapc5)
   04114 Oocyte meiosis
    59008 (Anapc5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    59008 (Anapc5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    59008 (Anapc5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    59008 (Anapc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59008 (Anapc5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    59008 (Anapc5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     59008 (Anapc5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    59008 (Anapc5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 VP4_haemagglut TPR_7 YycI
Other DBs
NCBI-GeneID: 59008
NCBI-ProteinID: NP_067480
MGI: 1929722
Ensembl: ENSMUSG00000029472
Vega: OTTMUSG00000054578
UniProt: Q8BTZ4
Position
5; 5 F
AA seq 740 aa
MMTNGVVHANLFGIKDWVTPYKIAVLVLLNEMGRTGEGAVSLVERRKLNQLLLPLLQGPD
ITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVV
GLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMDREDGEKQMEKEELDVS
VREEEVSCSGPLSQKQAEFFLSQQAALLKNDETKALTPASLQKELNNLLKFNPDFAEAHY
LSYLNNLRVQDVFSSTHSLLHYFDRLILTGAEGKSNGEEGYGRSLRYAALNLAALHCRFG
HYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRADSYVLLEHSVKKAVHFGLPY
LASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRS
TMALQQAQMLLSMNSLESLNAGVQQNNTESFAVALCHLAELHAEQGCFAAAGEVLKHLKD
RFPPNSQHAQLWMLCDQKIQFDRAMNDGKFHLADSLVTGITALNGIEGVYRKAVVLQAQN
QMTEAHKLLQKLLTYCQKLKNTEMVISVLLSVAELYWRSSSPTIAMPVLLEALALSKEYR
LQYLASETVLNLAYAQLILGIPEQALTLLHMAIEPILADGAVLDKGRAMFLVSKCQVASA
ASYDPVKKAEALEAAIQNLSEAKNYFAQVDCRERIRDVAYFQARLYHALGKTQERNHCAM
IFRQLHQELPAHGVPLINHL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgatgaccaacggggtagtgcacgccaacttgtttggcatcaaggactgggtgacgccc
tataagatcgccgtcctggtgctgctcaacgagatgggccgcacgggcgagggcgccgtc
agcctcgtggagcggcggaagctcaaccagctgctcctgcccctgctgcagggcccagat
attacactgtcaaagctgtacaagctaattgaagaatcgtgtcctcagctggcaaattca
gtgcagatcagaatcaagctcatggctgaaggcgaactgaaggatatggaacaatttttt
gatgacctttcagattctttttctggaactgaaccagaggttcacaaaacgagtgtagta
ggtctgttcctgcgccacatgatcttggcctacagtaagctttctttcagtcaagtgttt
aagctgtacactgccctccagcagtacttccagaacggggagaaaaagacggtggaagat
gctgatatggaccgagaggatggagagaaacagatggagaaggaagagctcgacgtgtcc
gtgagagaagaggaagtatcttgcagtggtcctctgtcccaaaaacaagcggaatttttt
ctctctcagcaggccgctttgttgaagaatgatgagactaaagccctcaccccagcttcc
ttgcagaaggaattgaacaacctgttgaaatttaatcctgattttgctgaagctcattac
ctcagctacttaaacaacctccgtgttcaagatgttttcagctcaacacacagcctcctg
cattattttgaccgcctgattctcactggagcggagggcaaaagtaatggggaagagggt
tatggccggagcctgagatacgctgctctcaacctggctgccctgcactgccgcttcggt
cactatcaacaggcagagctcgccctgcaggaggcaattaggattgcccaggagtccaac
gatcacgtgtgtctgcagcactgtttgagctggctttatgtgctggggcagaagagagcc
gatagctatgttctgctggagcactctgtgaagaaagcagtacattttgggttaccgtac
ctcgcctccctgggaatacagtcccttgttcaacagagagcttttgctgggaagacggcc
aacaaactgatggatgccctaaaggactctgacctcctgcactggaaacacagcctgtca
gaacttatcgatatcagcattgcacagaaaacggccatctggaggctgtacggccgcagc
accatggcactgcaacaagcccagatgttgctgagcatgaacagcctggagtcgctgaat
gcgggtgtgcagcagaacaatactgagtcctttgccgtcgctctctgccatcttgcagag
ctccatgcagaacagggctgttttgcggctgctggtgaagtattaaagcacttgaaggac
cgatttccacccaacagtcagcacgcccagttatggatgctgtgtgatcaaaaaatacag
tttgacagagcaatgaatgatggcaaattccatttggctgattcacttgttacaggaatc
acagcgcttaatggcatagaaggtgtatacaggaaagcagtcgtactgcaggctcagaac
caaatgacagaggcacacaagctactacagaagttgctgacgtactgtcagaagctaaag
aacacagaaatggtcatcagtgtcctcctatcggtggcagagctgtactggcgatcttcg
tccccgaccatcgccatgcctgtgctcctggaagctctggccctctccaaagaataccga
ttgcagtacttggcctccgaaactgtgctcaacttggcttatgcccagctcatccttgga
atcccggaacaggccttaacccttctccacatggctatcgagcccatcctagccgacggg
gctgtcctggacaaaggtcgtgccatgttcttagtgtccaagtgccaagtggcttcggca
gcgtcctatgacccagtgaagaaagcggaagctctggaagctgccattcagaacctcagt
gaagccaagaactactttgcacaagtcgactgcagagagcgcatcagggatgttgcttac
ttccaggccaggctgtaccacgctcttggcaagacccaggagaggaaccattgtgccatg
atcttccggcagctgcaccaggagttgcccgcccatggggtgcccttgattaaccacctc
tag

KEGG   Mus musculus (mouse): 66156
Entry
66156             CDS       T01002                                 

Gene name
Anapc11, 1110011I19Rik, R75218
Definition
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    66156 (Anapc11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    66156 (Anapc11)
   04114 Oocyte meiosis
    66156 (Anapc11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    66156 (Anapc11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    66156 (Anapc11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66156 (Anapc11)
   03036 Chromosome and associated proteins [BR:mmu03036]
    66156 (Anapc11)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     66156 (Anapc11)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    66156 (Anapc11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 66156
NCBI-ProteinID: NP_001033319
MGI: 1913406
Ensembl: ENSMUSG00000025135
Vega: OTTMUSG00000004083
UniProt: Q9CPX9
Position
11; 11 E2
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLNAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaaaattaaatgttggaatggtgtggccacttggctctgggtagccaatgat
gagaactgcggcatctgcaggatggcgtttaatggctgctgtccagactgtaaggtgcct
ggtgatgactgccccctcgtgtggggacagtgctcccactgcttccacatgcactgcatc
ctcaagtggctgaatgcgcagcaggtgcagcagcactgccccatgtgtcgccaggagtgg
aagttcaaagagtga

KEGG   Mus musculus (mouse): 66440
Entry
66440             CDS       T01002                                 

Gene name
Cdc26, 2010012C09Rik
Definition
(RefSeq) cell division cycle 26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    66440 (Cdc26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    66440 (Cdc26)
   04114 Oocyte meiosis
    66440 (Cdc26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    66440 (Cdc26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    66440 (Cdc26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    66440 (Cdc26)
   03036 Chromosome and associated proteins [BR:mmu03036]
    66440 (Cdc26)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     66440 (Cdc26)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    66440 (Cdc26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 66440
NCBI-ProteinID: NP_647452
MGI: 1913690
Ensembl: ENSMUSG00000066149
Vega: OTTMUSG00000014381
UniProt: Q99JP4
Position
4; 4 B3
AA seq 85 aa
MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGEGAAGLSSDPKSREQM
INDRIGYKPQLKSNNRTSQFGNFEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgctgcgacggaaaccgacccgcttagagctcaagctcgacgacattgaggagtttgag
agcattcgcaaggacctggaggcccgtaagaagcagaaggaagatgtggaaggtgtagga
accagcgatggagaaggagctgctgggctcagcagtgaccccaaaagccgggaacaaatg
attaatgatcgaattggttataaaccccaactcaagagcaacaaccgcacatctcagttt
ggaaactttgaattttag

KEGG   Mus musculus (mouse): 68999
Entry
68999             CDS       T01002                                 

Gene name
Anapc10, 1500026N15Rik, A830003M23Rik, APC10, Apc
Definition
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    68999 (Anapc10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    68999 (Anapc10)
   04114 Oocyte meiosis
    68999 (Anapc10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    68999 (Anapc10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    68999 (Anapc10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    68999 (Anapc10)
   03036 Chromosome and associated proteins [BR:mmu03036]
    68999 (Anapc10)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     68999 (Anapc10)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    68999 (Anapc10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 68999
NCBI-ProteinID: NP_081180
MGI: 1916249
Ensembl: ENSMUSG00000036977
Vega: OTTMUSG00000061320
UniProt: Q8K2H6
Position
8 C1; 8 37.79 cM
AA seq 185 aa
MTTPNKTPPGADPKQLERTATVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacaccgaacaagacacctcctggtgctgatcctaagcagttggagaggacagca
acagtcagggaaattgggtctcaggctgtttggtcactctcttcctgcaaaccagggttt
ggagtggatcaattacgggatgacaatctagaaacttactggcaatctgatggctctcag
cctcacttagtgaacatccaattcagaagaaaaacaacagtgaagacattatgtatttat
gcagactataagtctgatgaaagctacactccaagcaaaatctcagtcagagtaggaaat
aattttcacaaccttcaagaaatccggcaacttgaattggtggaaccaagtggctggatt
cacgttcctttaactgacaatcataagaagccaactcgcacattcatgatacagattgct
gttctagccaatcatcagaatggaagagatacccacatgagacaaattaagatatacaca
ccagtggaagagagctccattgggaaattccctagatgcacaaccattgatttcatgatg
tatcgttcaatacggtga

KEGG   Mus musculus (mouse): 69010
Entry
69010             CDS       T01002                                 

Gene name
Anapc13, 1810004D07Rik, APC13, SWM1
Definition
(RefSeq) anaphase promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    69010 (Anapc13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    69010 (Anapc13)
   04114 Oocyte meiosis
    69010 (Anapc13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    69010 (Anapc13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    69010 (Anapc13)
   03036 Chromosome and associated proteins [BR:mmu03036]
    69010 (Anapc13)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     69010 (Anapc13)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    69010 (Anapc13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 69010
NCBI-ProteinID: NP_852059
MGI: 1916260
Ensembl: ENSMUSG00000035048
Vega: OTTMUSG00000048442
UniProt: Q8R034
Position
9; 9 F1
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDL
ALQGLHENVPPAGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggtacagcgagatggaaggatcttggacctgattgatgatgcttggcgg
gaagataagctgccatatgaggatgtcgccattccactgagtgagcttcctgagcccgag
caagacaacggaggcaccacagagtctgtgaaagaacaggagatgaagtggacagacctg
gccttacagggcctccacgagaacgtcccacccgctggaaactga

KEGG   Mus musculus (mouse): 69957
Entry
69957             CDS       T01002                                 

Gene name
Cdc16, 2700071J12Rik, 2810431D22Rik, APC6
Definition
(RefSeq) CDC16 cell division cycle 16
  KO
K03353  anaphase-promoting complex subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    69957 (Cdc16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    69957 (Cdc16)
   04114 Oocyte meiosis
    69957 (Cdc16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    69957 (Cdc16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    69957 (Cdc16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    69957 (Cdc16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    69957 (Cdc16)
   03036 Chromosome and associated proteins [BR:mmu03036]
    69957 (Cdc16)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     69957 (Cdc16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     69957 (Cdc16)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    69957 (Cdc16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 SRP_TPR_like Dynein_light
Other DBs
NCBI-GeneID: 69957
NCBI-ProteinID: NP_081552
MGI: 1917207
Ensembl: ENSMUSG00000038416
Vega: OTTMUSG00000031373
UniProt: Q8R349 Q3TI84
Position
8; 8 A1.1
AA seq 620 aa
MNLEPLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDILDMEEPINRRLFEKYLKDDNGSRDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLDSLPLNKLCAEEQELLRFVFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSTVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVIHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFRDFEVEKQNTEEAGLAPLQNSTKAPESRPNLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacctggagccgctgcgcaaacgcgtccggcagtacctggaccagcaacagtatcaa
agtgctctgttttgggcagacaaggtagcttcactctctcatgaggagccccaggatgtt
tattggttggctcagtgcctttacctcacagcgcagtaccaccgagcagcccatgcgctc
cggtcacgcaagctggacaaattgtatgaagcttgccgataccttgcagctagatgccac
tatgctgcaaaagagcaccagcaggctctggacatccttgacatggaggagccaattaac
agaaggctctttgagaaatacctgaaggatgacaatggctcgagagacccttccagtgac
tgggagatgtcacagtcttccataaagagctcgatttgtctcctgagagggaagatctat
gatgctttagataatcgcaccctggctacctacagttacaaagaggctctgaaactggat
gtctactgctttgaagcctttgaccttttgacatcacaccacatgctgacagcacaggaa
gaaaaagaacttctggactccctgcctcttaacaagctctgtgctgaagaacaagagttg
ctgcgatttgtatttgagaacaaattaaagaagtataataagcccagtgaaacggtcatt
cccgagtcagtggacggcttgcaggagaatctggacgtggtagtgtctttagctgagaga
cactattacaactgtgattttaagatgtgctacaagcttacttctacagtgatggagaaa
gatcctttccatgcaaactgtttacctgtgcacataggaactcttgtggagctgaataaa
gcgaatgaacttttctatctttctcacaaactggtggatttatatccgagtaatcctgtg
tcttggtttgcggtgggatgttactatctcatggttggtcataaaaatgagcatgccaga
agatatctcagcaaagctaccacgttggagaagacctacggtcctgcctggatagcctac
gggcattccttcgctgtggagagtgagcacgaccaagcaatggctgcttacttcacagca
gcacagctgatgaaggggtgtcacttgccaatgctatatattggattagaatatggtctg
accaataactcgaaactggctgagcggttctttggccaagctctgagcatcgccccagaa
gacccatttgtcatccatgaggttggagtggttgcctttcagaatggagaatggaaaaca
gcagaaaaatggtttctcgatgctttggaaaaaattaaagcaattggaaatgaggtcaca
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaagaaa
tatgctgaggctttggattaccacaggcaggcactggtgctaatccctcagaacgcatcc
acctactctgctatagggtacatccacagtctgatgggcaactttgaaaacgctgtggac
tatttccacacagctcttggtctcaggcgagacgacacattttctgttacaatgcttggt
cactgcattgaaatgtacatcggggattcggaagcttatatcggagcagacattaaagac
aaattaaagtgctatgacttcgatgtgcatacaatgaaaacactaaaaaacatcatttcg
cctccatgggatttcagggactttgaagtagaaaagcagaacacagaggaagcgggactt
gcacctctgcaaaactccactaaagctccagagtccagacctaacttggaagagactttt
gaaattgaaatgaacgaaagtgacatgatgctagagacgtctatgtcagaccacagcaca
tag

KEGG   Mus musculus (mouse): 99152
Entry
99152             CDS       T01002                                 

Gene name
Anapc2, 9230107K09Rik, AL024279, AP, Apc2, Emi, Emi4, Im, Imi4, mKIAA1406
Definition
(RefSeq) anaphase promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    99152 (Anapc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    99152 (Anapc2)
   04114 Oocyte meiosis
    99152 (Anapc2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    99152 (Anapc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    99152 (Anapc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    99152 (Anapc2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    99152 (Anapc2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     99152 (Anapc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    99152 (Anapc2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 99152
NCBI-ProteinID: NP_780509
MGI: 2139135
Ensembl: ENSMUSG00000026965
Vega: OTTMUSG00000011902
UniProt: Q8BZQ7
Position
2; 2 A3
AA seq 837 aa
MEAEGVAVAAAAAAAAAAATIIASDDCDSRPGQELLVAWNTVSTGLVPPAALGLASSRTS
GAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQGNIATEFWNAIALRENSVDEP
QCLGLLLDAFGLLESRLDPYLHSLELLEKWTRLGLLMGAGAQGLREKVHTMLRGVLFFST
PRTFQEMVQRLYGRFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCG
SDKQQCWCRQALEQFNQLSQVLHRLSLLERVCAEAVTTTLHQVTRERMEDRCRGEYERSF
LREFHKWIERVVGWLGKVFLQDNPTRPTSPEAGNTLRRWRCHVQRFFYRIYATLRIEELF
SIIRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKVALETRLLHPGVNTCDIITLYISAIK
ALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPACLE
TGQDSEDDSGEPEDWVPDPVDADPVKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLAD
RLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPVEE
QPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVT
MDVELADRTLSVAVTPVQAVVLLYFQNQASWTLEELSKVVKMPVALLRRRMSVWLQQGVL
REEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWAYIQAMLTNL
ESLSLERIYSMLRMFVMTGPALAEIDLQELQGYLQKKVRDQQLIYSAGVYRLPKNSN
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggaggccgagggtgtggcggtggcggcggcggcggcggcggcggcggcggcggcgaca
attattgcctccgatgactgcgactctaggcctggacaggagctcttggttgcctggaat
actgtgagcaccggtctggtgccgccggccgcgctggggctggcgtcttcccggaccagc
ggtgcagtcccaccaaaggaggaagagcttcgtgcagcggtggaggttctgaggggacac
ggtctgcactctgtcctggaggagtggttcgtggaagtgctgcagaacgaccttcaaggc
aatattgccacggagttctggaatgccatcgctctgcgagaaaactctgtcgatgagccc
cagtgccttgggctgctcctggatgcgttcggtctgctggaaagccgcttggatccctat
ctgcatagcctagaactcctagagaaatggactcgtctgggcttgctgatgggcgctgga
gctcaggggcttcgggagaaagttcacactatgttgcggggagtcctgtttttttccacc
cctaggacattccaggagatggtccagcgcctctatggtcgtttcttgagagtctatatg
cagagcaagagaaaaggagaagggggcacagacccggaactagagggtgagctagatagc
cggtatgcccgccgcaggtactaccgacttttgcagagtcctctgtgcgcaggatgtggc
agtgacaagcagcagtgctggtgccggcaggcactggagcagttcaaccagctgagccag
gtcctgcataggctcagtctgctggagcgggtttgtgctgaggccgtgacaaccaccctg
catcaggtgacccgggaaaggatggaagaccgctgccgaggagagtatgagcgctctttt
ttgcgtgagtttcacaagtggatagagagagtggttggttggcttggcaaagtgttcctt
caggacaaccccaccagaccaacttctccagaagctgggaacacactgcgtcgttggcgc
tgccacgtacagagattcttctaccgtatctatgccaccctacgcatcgaggagcttttc
agcatcatccgagactttccagactcccggccagccattgaagaccttaagtactgcttg
gagaggacagatcagaggcagcaacttcttgtgtccctcaaggtggccctagagactcga
ctcctccacccaggtgtcaacacatgtgacatcatcactctctacatttctgccatcaag
gcattacgtgtgctagatccctctatggtcatcctggaagtggcttgtgagcccatccgt
cgatacctgaggacacgagaggacaccgtacggcagattgtggctgggctaaccggggac
tcagatgggactggggacttggctgttgagctgtctaagactgaccctgcctgcctggag
accggtcaggacagtgaggatgattctggagagcccgaggactgggtccctgaccctgtg
gatgctgatccagtgaagtcgagttccaagcgacgttcttcagacatcatcagcctgctg
gtcagcatctatggcagcaaagacctctttatcaatgagtaccgctcgctacttgcagat
cgccttctccaccaattcagcttcagccctgagagggagattcgtaatgtggagctgttg
aagctgcgctttggtgaagcccccatgcacttctgtgaggtcatgctcaaggacatggca
gactcccgccgcatcaatgccaatatccgagaggaggatgagaagcggcctgtggaagaa
cagccaccatttggggtctatgctgtcatattgtccagtgaattttggcctcccttcaaa
gatgagaagctggaggtccctgaggacatcagggcagccctagacgtttactgcaagaag
tatgagaaactgaaggctatgcggacacttagttggaagcacaccctgggcctggtgaca
atggatgtggagcttgctgaccgcaccctgtctgttgcggtgaccccagtacaggcagtg
gtcttgctgtatttccagaaccaagccagctggaccctggaggaactgagcaaggtggtg
aagatgcctgtggcactgcttcgaagacgcatgtcagtgtggctgcaacagggtgtgctg
cgggaggaacctccaggcactttctctgtcattgaggaagagcggcctcaggatagggac
aacatggtgctgattgacagtgatgatgagagtgactcaggcatggcctcccaggctgac
cagaaggaagaggagctactgctcttctgggcatacatccaggccatgttaaccaaccta
gagagcctctctctggagcgtatctacagcatgctccggatgtttgtaatgactggccct
gcgctggctgagattgacctgcaggagctgcagggctacttgcagaagaaggtccgagac
cagcagctcatctattctgcaggtgtctaccgcctgcctaagaattccaactga

DBGET integrated database retrieval system