KEGG   Mus musculus (mouse): 17227Help
Entry
17227             CDS       T01002                                 

Gene name
Mcpt4, MMCP-4, MMCP-4A, MMCP-4B, Mcp-4, Mcp4
Definition
(RefSeq) mast cell protease 4
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    17227 (Mcpt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    17227 (Mcpt4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     17227 (Mcpt4)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   17227 (Mcpt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 17227
NCBI-ProteinID: NP_034909
MGI: 96940
Ensembl: ENSMUSG00000061068
UniProt: P21812 Q3UN88
Position
14 C3; 14 28.19 cM
AA seq 246 aa AA seqDB search
MQALLFLMALLLPSGAGAEEIIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFV
LTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAK
ETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDILREVKLRIMDKEACKNYWHY
DYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWIN
RVIKGK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccctactattccttatggcacttctcttgccttctggggctggagctgaggag
attattggtggtgttgagtctagaccacattctcgcccttacatggcccatctggagatc
accactgagagagggttcacagctacctgtggtgggtttctcataacccgccaatttgtg
ttgactgctgcacactgtagtggaagagaaatcactgtcacccttggagctcatgatgtg
agcaagacagaatccacacagcagaagataaaagtagaaaaacaaatcgttcacccaaag
tacaacttctattccaatctccatgacatcatgttgctgaagcttcaaaagaaagccaaa
gagactccctctgtgaatgtaattcctctgcctcgtccttctgactttatcaagccgggg
aagatgtgccgggcagctggctgggggcgaactggagtgacagaacctacctcagatata
ctgagggaggtgaaactgagaatcatggataaagaggcctgtaaaaactattggcattac
gactataacctccaggtctgcgtgggcagtcccagaaagaaaagatcagcatacaaggga
gactctggaggacctctactgtgtgctggggtggcccatggtattgtatcttatggacgc
ggagatgcaaagccccctgcagtcttcacccgaatctcctcatatgtgccctggattaac
agagttataaagggcaagtag

DBGET integrated database retrieval system