KEGG   Mus musculus (mouse): 17228Help
Entry
17228             CDS       T01002                                 

Gene name
Cma1, MMCP-5, Mcp-5, Mcp5, Mcpt5
Definition
(RefSeq) chymase 1, mast cell
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    17228 (Cma1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17228 (Cma1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     17228 (Cma1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   17228 (Cma1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Peptidase_S29
Motif
Other DBs
NCBI-GeneID: 17228
NCBI-ProteinID: NP_034910
MGI: 96941
Ensembl: ENSMUSG00000022225
UniProt: P21844 A4QPC5
Position
14 C3; 14 28.19 cM
AA seq 247 aa AA seqDB search
MHLLTLHLLLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNF
VLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKA
KLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTS
FRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWI
NKILREN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcttactcttcatctgctgctccttctcctgggttccagcaccaaagctgga
gagatcattggaggcacggagtgcataccacactcccgcccctacatggcctatctggaa
attgtcacttctgagaactacctgtcggcctgcagtggcttcctgataagaagaaacttt
gtgctgactgcagctcactgtgcgggaaggtctataacagtcctcctaggagcccataac
aaaacatctaaagaagacacgtggcagaagcttgaggtggaaaagcaattccttcatcca
aaatatgatgagaatttggttgtccacgacatcatgctactgaagttgaaggagaaagcc
aagctaaccctaggtgtgggaaccctcccactctctgccaacttcaactttatcccaccc
gggagaatgtgcagggcagttggctggggcagaacaaacgtgaatgagccagcctccgac
acactgcaggaagtaaagatgagactccaggagccccaagcctgcaaacacttcaccagt
tttcgacacaattcccagctgtgtgtgggcaaccccaagaagatgcaaaatgtatacaag
ggagactctggaggacctctgctgtgtgctgggatagcccaaggcattgcatcctatgta
catcggaatgcaaagccccctgctgtctttaccagaatctcccattacaggccctggatc
aataagatcttgagggagaattaa

DBGET integrated database retrieval system