KEGG   Mus musculus (mouse): 17229Help
Entry
17229             CDS       T01002                                 

Gene name
Tpsb2, AV011504, MMCP-6, Mcp-6, Mcp6, Mcpt6
Definition
(RefSeq) tryptase beta 2
  KO
K01340  tryptase [EC:3.4.21.59]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    17229 (Tpsb2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.59  tryptase
     17229 (Tpsb2)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   17229 (Tpsb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 17229
NCBI-ProteinID: NP_034911
MGI: 96942
Ensembl: ENSMUSG00000033825
UniProt: E9QJW9
Position
17 A3.3; 17 12.53 cM
AA seq 276 aa AA seqDB search
MLKRLLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFC
GGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGG
ADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVK
VPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQA
GVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYVPEHS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcggctgctgctgctgctgtgggcactgtccctcctggctagtctggtgtac
tcggcccctcgcccagccaatcagcgagtgggcatcgtgggaggacatgaggcttctgag
agtaagtggccctggcaggtgagcctgagatttaaattaaactactggatacatttctgc
ggaggttctctcatccatccacagtgggtgctcactgcggcacactgtgtgggaccgcac
atcaaaagcccacagctcttccgggtgcagcttcgtgagcagtatctatactatggggac
cagctcctctctttgaacaggatcgtggtgcacccccactattacacggccgagggtggg
gcagacgttgccctgctggagcttgaggtccctgtgaatgtctctacccatctccacccc
atatccctgccccctgcctcggagaccttccccccagggacatcgtgctgggtgacaggc
tggggcgacattgataatgacgagcctctcccacctccttatcctctgaagcaagtgaag
gttcccattgtggaaaacagcctgtgtgaccggaagtaccacactggcctctacacggga
gatgattttcccattgtccatgatggcatgctgtgtgctggaaataccaggagagactcc
tgccagggcgattcaggggggccactggtctgcaaagtgaagggtacctggctgcaggca
ggagtggtcagctggggtgagggctgcgcacagcccaacaagcctggcatctacacccgg
gtgacatactacttagactggatccaccgctatgtccctgagcattcctga

DBGET integrated database retrieval system