KEGG   Mus musculus (mouse): 17252
Entry
17252             CDS       T01002                                 

Gene name
Rdh11, 2610319N22Rik, AI428145, AU045252, Arsdr1, C85936, CGI-82, HCBP12, M42C60, Mdt1, Psdr1, SCALD, UBE-1c1, Ube-1c, ralR1
Definition
(RefSeq) retinol dehydrogenase 11
  KO
K11152  retinol dehydrogenase 11 [EC:1.1.1.300]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    17252 (Rdh11)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     17252 (Rdh11)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase AdoHcyase_NAD NAD_binding_10 GDP_Man_Dehyd
Other DBs
NCBI-GeneID: 17252
NCBI-ProteinID: NP_067532
MGI: 102581
Ensembl: ENSMUSG00000066441
Vega: OTTMUSG00000034945
UniProt: Q9QYF1
Position
12 C3; 12 35.51 cM
AA seq 316 aa
MFGFLLLLSLPFILYLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQ
RGARVYLACRDVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHL
LINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLG
RIHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYS
SIMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIAR
RLWDVSCDLLGLPVDW
NT seq 951 nt   +upstreamnt  +downstreamnt
atgttcggattcctgcttctgctctctcttcccttcatcctgtacttggtcacgccaaaa
atcaggaaaatgctgtccagtggggtgtgcacatctaatgttcagcttcccgggaaggta
gccatagtcactggtgctaacacaggcattgggaaggagacagctaaagatctggcccaa
agaggagcccgtgtgtatttagcttgccgggatgtggacaagggggaactggcggctcgt
gagatccaagccgtcacagggaacagtcaggtcttcgtacggaaactggacctagctgat
accaagtctattcgagcctttgccaaagacttcttagctgaggaaaagcatctgcacctt
ctcatcaacaatgcgggcgtgatgatgtgcccctactcgaagactgcagacggctttgag
atgcacattggcgtcaaccacctgggtcacttcctcctgacccatttgctgctagaaaag
ctgaaggagtcggccccatcaaggatagtcaacttgtcttctttgggacaccatctgggc
aggatccacttccataacctgcagggggagaagttctacagtgcgggtctcgcgtactgc
cacagcaaactagccaacattctcttcactaaggagctggccaagaggctgaaaggttct
ggagtgacaacatactctgtacaccctggcacagtccattctgaattgacgcggtactcc
tctattatgagatggctttggcaacttttctttgttttcatcaagacccctcaagaggga
gctcagacgagcctgtactgtgccctgacagaaggtctcgagagcctaagtggcagtcat
ttcagtgattgccagttggcatgggtctcttaccaaggtcgcaatgagataatagccagg
cggctgtgggatgtcagctgtgacctgctgggcctcccagtggattggtaa

DBGET integrated database retrieval system