KEGG   Mus musculus (mouse): 17254
Entry
17254             CDS       T01002                                 

Gene name
Slc3a2, 4F2, 4F2HC, AI314110, Cd98, Ly-1, Ly-10, Ly-m1, Ly-m10, Ly10, Mdu1, Mgp-2h, Mgp-2hc, NACAE
Definition
(RefSeq) solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
  KO
K06519  solute carrier family 3, member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04216  Ferroptosis
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    17254 (Slc3a2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    17254 (Slc3a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    17254 (Slc3a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    17254 (Slc3a2)
   04147 Exosome [BR:mmu04147]
    17254 (Slc3a2)
   04090 CD molecules [BR:mmu04090]
    17254 (Slc3a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC3: Heavy subunits of the heteromeric amino acid transporters
   17254 (Slc3a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   17254 (Slc3a2)
CD molecules [BR:mmu04090]
 Proteins
  17254 (Slc3a2)
SSDB
Motif
Pfam: SLC3A2_N Alpha-amylase Malt_amylase_C DUF3459 YlxR
Other DBs
NCBI-GeneID: 17254
NCBI-ProteinID: NP_032603
MGI: 96955
Ensembl: ENSMUSG00000010095
Vega: OTTMUSG00000057838
UniProt: P10852
Structure
PDB: 
6I9Q

Position
19 A; 19 5.44 cM
AA seq 526 aa
MSQDTEVDMKDVELNELEPEKQPMNAADGAAAGEKNGLVKIKVAEDETEAGVKFTGLSKE
ELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRI
GDLQAFVGRDAGGIAGLKSHLEYLSTLKVKGLVLGPIHKNQKDEINETDLKQINPTLGSQ
EDFKDLLQSAKKKSIHIILDLTPNYQGQNAWFLPAQADIVATKMKEALSSWLQDGVDGFQ
FRDVGKLMNAPLYLAEWQNITKNLSEDRLLIAGTESSDLQQIVNILESTSDLLLTSSYLS
NSTFTGERTESLVTRFLNATGSQWCSWSVSQAGLLADFIPDHLLRLYQLLLFTLPGTPVF
SYGDELGLQGALPGQPAKAPLMPWNESSIFHIPRPVSLNMTVKGQNEDPGSLLTQFRRLS
DLRGKERSLLHGDFHALSSSPDLFSYIRHWDQNERYLVVLNFRDSGRSARLGASNLPAGI
SLPASAKLLLSTDSARQSREEDTSLKLENLSLNPYEGLLLQFPFVA
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgagccaggacaccgaagtggacatgaaagatgtggagctgaacgagctagaaccggag
aagcagcccatgaatgcagcggacggggcggcggccggggagaagaacggtctggtgaag
atcaaggtggcggaggacgagacggaggccggggtcaagttcaccggcttatccaaggag
gagctactgaaggtagcgggcagccctggctgggtgcgcacccgctgggcgctgctgctg
ctcttctggctcggttggctgggcatgctggcgggcgccgtggttatcatcgttcgggcg
ccgcgctgccgtgagctgcctgtacagaggtggtggcacaagggcgccctctaccgcatc
ggcgaccttcaggcctttgtaggccgggatgcgggaggcatagctggtctgaagagccat
ctggagtacttgagcaccctgaaggtgaagggcctggtgttaggcccaattcacaagaac
cagaaggatgaaatcaatgaaaccgacctgaaacagattaatcccactttgggctcccag
gaagattttaaagaccttctacaaagtgccaagaaaaagagcattcacatcattttggac
ctcactcccaactaccagggccagaatgcgtggttcctccctgctcaggctgacattgta
gccaccaaaatgaaggaagctctgagttcttggttgcaggacggtgtggatggtttccaa
ttccgggatgtgggaaagctgatgaatgcacccttgtacttggctgagtggcagaatatc
accaagaacttaagtgaggacaggcttttgattgcagggactgagtcctctgacctgcag
caaattgtcaacatacttgaatccaccagcgacctgctgttgaccagctcctacctgtca
aattccactttcactggggagcgtactgaatccctagtcactaggtttttgaatgccact
ggcagccaatggtgcagctggagtgtgtcgcaagcaggactcctcgcagactttataccg
gaccatcttctccgactctaccagctgctgctcttcactctgccagggactcctgttttt
agctacggggatgagcttggccttcagggtgcccttcctggacagcctgcgaaggcccca
ctcatgccgtggaatgagtccagcatctttcacatcccaagacctgtaagcctcaacatg
acagtgaagggccagaatgaagaccctggctccctccttacccagttccggcggctgagt
gaccttcggggtaaggagcgctctctgttgcacggtgacttccatgcactgtcttcctca
cctgacctcttctcctacatacgacactgggaccagaatgagcgttacctggtggtgctc
aacttccgagattcgggccggtcagccaggctaggggcctccaacctccctgctggcata
agcctgccagccagcgctaaacttttgcttagtaccgacagtgcccggcaaagccgtgag
gaggacacctccctgaagctggaaaacctgagcctgaatccttatgagggcttgctgtta
cagttcccctttgtggcctga

DBGET integrated database retrieval system