KEGG   Mus musculus (house mouse): 17256
Entry
17256             CDS       T01002                                 
Symbol
Mea1, Mea-1
Name
(RefSeq) male enhanced antigen 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: MEA1
Other DBs
NCBI-GeneID: 17256
NCBI-ProteinID: NP_001264239
MGI: 96957
Ensembl: ENSMUSG00000002768
UniProt: Q64327
Position
17:46989727..46994052
AA seq 174 aa
MAAVVLGGDTMGPERIFPNQTEDLGPHQGPTEGTGDWSSEEPEEEQEETGAGPAGYSYQP
LNQDPEQEEVELAPVGEGEDGAADIQDRIQALGLHLPDPPLESEDEDEEGAAALSSHSSI
PMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK
NT seq 525 nt   +upstreamnt  +downstreamnt
atggcagcagtagttctagggggagacaccatgggccctgagcgtatcttccccaatcag
actgaggacttagggccacatcagggtcctacagaaggaactggggattggagcagtgaa
gaacccgaggaagagcaggaggaaacaggagcaggcccagcaggctactcgtaccagccc
ctcaatcaagaccctgaacaagaagaggtggaattggcaccagtgggtgaaggagaagat
ggagctgctgacatccaagatcggatccaggccctggggcttcatctgccagaccctcca
ttggagagtgaggatgaagatgaggagggagccgccgcattgagcagccacagctctatc
cccatggacccagaacatgtagagctggtgaaaaggacgatggctggagtaagcctgcct
gcaccaggggttcctgcctgggctcgggagatctcggacgctcagtgggaagatgtggta
cagaaagccctccaagcccggcaggcatcccctgcctggaagtga

DBGET integrated database retrieval system