KEGG   Mus musculus (mouse): 17258
Entry
17258             CDS       T01002                                 

Symbol
Mef2a, A430079H05Rik
Name
(RefSeq) myocyte enhancer factor 2A
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04371  Apelin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17258 (Mef2a)
   04022 cGMP-PKG signaling pathway
    17258 (Mef2a)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    17258 (Mef2a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17258 (Mef2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17258 (Mef2a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    17258 (Mef2a)
SSDB
Motif
Pfam: SRF-TF HJURP_C TFIIA
Other DBs
NCBI-GeneID: 17258
NCBI-ProteinID: NP_001028885
MGI: 99532
Ensembl: ENSMUSG00000030557
Vega: OTTMUSG00000021127
UniProt: Q60929
Position
7 C; 7 36.72 cM
AA seq 498 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNE
DSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLADSSMLSP
PPATLHRNVSPGAPQRPPSTGSASGMLSTTDLTVPNGAGNSPVGNGFVNSRASPNLIGNT
GANSLGKVMPTKSPPPPGGGSLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNAQRIS
SSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFTSPGMLSLG
QASAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQQQ
QQQPQQQPPPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNT
EDRESPSVKRMRMDTWVT
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggggcgaaagaagatacaaatcacacgcataatggatgagaggaaccgacaggttact
tttacaaagcgaaagtttggattgatgaagaaagcctatgaactcagtgtgctctgtgac
tgtgaaatagcactcatcattttcaacagctctaataagctgtttcagtacgctagcact
gacatggacaaagtccttctcaaatacactgagtataacgagcctcatgaaagcaggacg
aactcggatatcgttgagacgttaagaaagaaaggccttaatggttgtgagagccctgat
gctgacgattactttgagcacagtccactctcggaggacagattcagcaaactaaatgaa
gatagtgattttattttcaaacgaggccctcctggcttgccacctcagaacttctcaatg
tctgtcacagtccctgtgaccagccctaatgctttgtcgtacactaacccagggagttca
ctcgtgtcaccgtctttggcagccagctcaacattagcagattcgagcatgctgtctcca
cccccagccacgctacatagaaatgtgtccccaggagctccgcagagaccaccaagtacc
ggcagtgcaagtgggatgttgagcactacagacctcacggtgccaaatggagctggaaat
agtcctgtggggaatggatttgtaaactcaagggcctctccaaatttgattggaaatact
ggtgcaaatagtttaggcaaagtcatgcctacaaagtctcccccgccaccaggtggtggc
agtcttggaatgaacagtcggaaaccagatctacgagttgtcattcccccatcaagcaag
ggcatgatgcccccactttcggaggaagaggaattggagttgaatgcccaaaggataagc
agttctcaagccactcaacctcttgccacgcctgtagtgtctgtgacaactccgagcttg
cctccacagggactagtgtactcagcaatgccgacagcctacaacactgattactcactg
accagcgctgacctgtctgccctgcaaggctttacttcccctggaatgctgtctctgggg
caggcttcagcctggcagcagcaccatctaggacaagcagccctcagctctctggtggct
ggagggcagttatctcagggttcaaatttgtccattaacaccaaccagaacatcaacatt
aagtcagagccaatttcacctccccgtgatagaatgaccccatcaggcttccaacagcag
cagcagcagccacaacagcagccaccgccacaacctccacagccccaaccccggcaggaa
atggggcgctcccctgtggacagtctgagcagctccagcagctcctatgatggcagtgac
cgggaggatccacggggtgacttccattctccaattgtgcttggccgacctccaaatact
gaggacagagaaagcccttctgtaaaacgcatgaggatggacacatgggtgacctaa

DBGET integrated database retrieval system