KEGG   Mus musculus (mouse): 17259
Entry
17259             CDS       T01002                                 

Symbol
Mef2b, AI451606
Name
(RefSeq) myocyte enhancer factor 2B
  KO
K09261  MADS-box transcription enhancer factor 2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17259 (Mef2b)
   04022 cGMP-PKG signaling pathway
    17259 (Mef2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17259 (Mef2b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    17259 (Mef2b)
SSDB
Motif
Pfam: SRF-TF NUDE_C
Other DBs
NCBI-GeneID: 17259
NCBI-ProteinID: NP_001038949
MGI: 104526
Ensembl: ENSMUSG00000079033
Vega: OTTMUSG00000022207
UniProt: Q80VR4
Position
8:70605411..70620138
AA seq 339 aa
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCDIALIIFNSAQRLFQYASS
DMDRVLLKYTEYSEPHESRTNADILQTLKRRGVGLDGPELDMEEGPEGPGEKLLRTLGGD
RGSASPPPRIYPVAPAMSVSELSYRVPPATPGCDPGGLGEAPSVHSRPPHFRPPGLGHPI
FSPSHLASKTPPPLYLATDGRRPDLPPGLRSLYSGLQSPGAPGPALGSFAFLPSGSTDCS
PGDAAQGPLQPSPWPPTRDAVDPARPVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTG
TSGDFPRSFPYPLLLARPLAEPLRPSASLHRLTPDSWPR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggggaggaaaaaaatccagatctcacgaattctagaccaaaggaacaggcaggtgact
ttcaccaagcgcaagttcggactgatgaagaaggcttatgagctgagcgtgctttgtgac
tgcgacattgccctgatcatcttcaacagcgcgcaacgcctcttccagtatgcgagcagc
gacatggaccgggtgctgctcaaatacaccgagtacagtgagccgcacgagagccgcacc
aacgcggatatccttcagacactgaagaggaggggcgtgggccttgatgggcccgagctg
gatatggaggaggggccagaaggtcctggagagaagctgctgaggacactggggggtgac
agaggctcggcctcgcccccgcctcggatctatcccgtggcccccgcaatgtcggtttca
gagctgtcctaccgggtcccaccagccactccaggctgtgatcctggcgggctgggggag
gccccgtctgtccacagccgcccgcctcactttcgacccccgggcctgggacacccgatc
ttctctccaagccaccttgcgagcaagacgcccccgcctctgtacctggcgactgatggg
cggaggccagacctgccccctggcctgagaagcctgtacagcggcctgcagagtcccggt
gccccaggccccgctctgggtagctttgccttcttaccatcaggctccacagattgcagc
ccgggagacgcagctcagggacccctgcaaccctcaccctggccaccaacgagggacgct
gtagaccccgcccggccagttgcccgcagtctgtgcaaggagggtccccccagccgaggg
gcctcccctccgacacctccggtcagcatcaagtctgagcgactgtctccagtcactggg
acctctggcgacttccccaggtccttcccctacccgctgctccttgccaggccccttgca
gagccactgcggccctcggcctccctgcaccgcttgacccctgacagctggccacggtag

DBGET integrated database retrieval system