KEGG   Mus musculus (mouse): 17260
Entry
17260             CDS       T01002                                 

Gene name
Mef2c, 5430401D19Rik, 9930028G15Rik, AV011172, Mef2
Definition
(RefSeq) myocyte enhancer factor 2C
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04371  Apelin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05202  Transcriptional misregulation in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17260 (Mef2c)
   04371 Apelin signaling pathway
    17260 (Mef2c)
   04022 cGMP-PKG signaling pathway
    17260 (Mef2c)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    17260 (Mef2c)
   04928 Parathyroid hormone synthesis, secretion and action
    17260 (Mef2c)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17260 (Mef2c)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17260 (Mef2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17260 (Mef2c)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    17260 (Mef2c)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 17260
NCBI-ProteinID: NP_001334493
MGI: 99458
Ensembl: ENSMUSG00000005583
Vega: OTTMUSG00000044481
UniProt: Q8CFN5
Structure
PDB: 
5F28

Position
13 C3; 13 43.68 cM
AA seq 474 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPSFEMPVTIPVSSHNSLVYSNPVSTLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNIQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLSIKSEPVSPPRDRTTTPSRYPQHTTRHEAGRS
PVDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacgaggataatggatgagcgtaacagacaggtgact
tttacgaagaggaaatttggattgatgaagaaggcttatgagctgagcgtgctgtgcgac
tgtgagattgcactgatcatcttcaacagcaccaacaagctgttccagtacgccagcact
gacatggataaggtgttgctcaagtacaccgagtacaacgagccgcacgagagccggaca
aactcagacattgtggagacattgagaaagaagggcctcaatggctgtgacagcccagat
cccgatgcagacgattcagtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccacctcccagc
tttgagatgccagttaccatcccagtgtccagccataacagtttggtgtacagcaatcct
gtcagcacactgggaaaccccaatcttctgccactggcccacccgtctctgcagaggaat
agtatgtctcctggtgtaacacatagacctccaagtgcaggtaacacaggcggtctgatg
ggcggagatctgacatccggtgcaggcaccagcgcagggaatggatacggcaacccccgg
aactcaccaggcctgctggtctcacctggtaacctgaacaagaatatacaagccaaatct
cctccccctatgaatctaggaatgaataatcgtaagccagatctccgcgttcttatccca
cctggcagcaagaacacgatgccatcagtgtctgaggatgtggatctgctgttgaatcaa
aggataaataactcccagtcggctcagtcattggctaccccggtggtttccgtagcaact
cctactttaccaggacaaggaatgggaggatatccatcagccatttcaacaacatatggt
actgagtactctctgagtagcgcagatctgtcatctctgtctggcttcaacactgccagt
gcgctccacctcggctctgtaactggctggcagcagcagcacctacataacatgccgcca
tctgccctcagtcagttgggagcttgcactagcactcatttatctcagagttcaaatctc
tccctgccttctactcaaagcctcagcatcaagtcagaacctgtttctcctcctagagac
cgtaccaccaccccttcgagatacccacaacacaccacgcgccacgaggcggggaggtct
cctgttgacagcttgagcagctgtagcagttcctacgatgggagcgaccgagaggatcac
cggaacgaattccactcccccattggactcaccagaccttcgccggacgaaagggaaagt
ccttcagtcaagcgcatgcgactctctgaaggatgggcaacatga

DBGET integrated database retrieval system