KEGG   Mus musculus (house mouse): 17274
Entry
17274             CDS       T01002                                 
Symbol
Rab8a, AA409338, Mel
Name
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04140  Autophagy - animal
mmu04144  Endocytosis
mmu04152  AMPK signaling pathway
mmu04530  Tight junction
mmu04972  Pancreatic secretion
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    17274 (Rab8a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17274 (Rab8a)
   04140 Autophagy - animal
    17274 (Rab8a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    17274 (Rab8a)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    17274 (Rab8a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    17274 (Rab8a)
   05022 Pathways of neurodegeneration - multiple diseases
    17274 (Rab8a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17274 (Rab8a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17274 (Rab8a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17274 (Rab8a)
   04031 GTP-binding proteins [BR:mmu04031]
    17274 (Rab8a)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    17274 (Rab8a)
 Autophagy
  Other autophagy associated proteins
    17274 (Rab8a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    17274 (Rab8a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   17274 (Rab8a)
  Exosomal proteins of other body fluids (saliva and urine)
   17274 (Rab8a)
  Exosomal proteins of colorectal cancer cells
   17274 (Rab8a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    17274 (Rab8a)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16
Other DBs
NCBI-GeneID: 17274
NCBI-ProteinID: NP_075615
MGI: 96960
Ensembl: ENSMUSG00000003037
UniProt: P55258 Q0PD50
Structure
Position
8:72915044..72935210
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSSHGVKITVEQQKRTSFFRCSLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtaggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacattcatctctacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagaggattaaactgcag
atatgggacacggccggccaggagcggtttcgaacaatcacgacagcctactacaggggt
gccatgggtatcatgctggtctacgacattaccaatgagaagtcctttgacaacatccgg
aattggattcggaacattgaagagcatgcctctgcagacgtggagaagatgatactgggg
aataagtgtgatgtgaatgacaagagacaggtgtccaaggaacggggagaaaagctggca
ctcgactatgggatcaagttcatggagaccagtgcaaaggccaacatcaatgtggagaat
gcatttttcactcttgccagggatatcaaagcaaaaatggacaaaaaattggaagggaac
agcccgcaggggagcagccatggagtcaagatcacagtggagcagcagaagaggaccagc
ttcttccggtgcagtctcctgtga

DBGET integrated database retrieval system