KEGG   Mus musculus (mouse): 17285
Entry
17285             CDS       T01002                                 

Gene name
Meox1, AI385561, D330041M02Rik, Mox-1, Mox1
Definition
(RefSeq) mesenchyme homeobox 1
  KO
K09322  homeobox protein MOX
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17285 (Meox1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    17285 (Meox1)
SSDB
Motif
Pfam: Homeodomain SAM_MT
Other DBs
NCBI-GeneID: 17285
NCBI-ProteinID: NP_034921
MGI: 103220
Ensembl: ENSMUSG00000001493
Vega: OTTMUSG00000002088
UniProt: P32442
Position
11 D; 11 65.48 cM
AA seq 253 aa
MDPVANSCVRNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSFHQKSDFPATAAYPDF
SASCLAATPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPG
LVDGTAGLGEDCMVLGTIANETEKKSSRRKKERSDNQENGGGKPEGSSKARKERTAFTKE
QLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPVSPQEQD
REDGDSAASPSSE
NT seq 762 nt   +upstreamnt  +downstreamnt
atggatccagtggccaacagctgtgtgaggaacccccagcccccagcccctgtctggggc
tgccttcgaaacccccactcagaagatagcagcgcctcagggctgtcccattatccccca
accccgttttccttccaccaaaaatcagacttcccagcgacagcagcataccccgacttc
tctgcttcctgcctggcagccaccccacacagcctgccccggactgagcgaatcttcaac
gagcagcatcctgccttcccacagacccctgactggcacttccctatctcagaagccggg
cagaggctcaacctaggcccagctgggagcgccagggagatgggagccggcagccccggc
ctggtggatggcacagcaggattgggggaggattgcatggtacttgggacgatcgccaat
gagacggagaagaaatcatccagaaggaaaaaagagaggtcagacaaccaggagaacgga
ggagggaagccagaaggcagcagcaaagcccggaaggagaggacagccttcaccaaggag
cagctacgggagctggaggcagagtttgcccaccacaactacctgacccggctccggaga
tatgagattgcagtcaacctggacctttctgagcggcaggtcaaagtctggttccagaac
cggaggatgaagtggaaacgtgtgaaggggggtcagcctgtgtccccacaggagcaggac
cgagaggatggggactctgcagcttctccaagttcagagtga

DBGET integrated database retrieval system