KEGG   Mus musculus (house mouse): 17286
Entry
17286             CDS       T01002                                 
Symbol
Meox2, Gax, Mox-2, Mox2
Name
(RefSeq) mesenchyme homeobox 2
  KO
K09322  homeobox protein MOX
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17286 (Meox2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    17286 (Meox2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 17286
NCBI-ProteinID: NP_032610
MGI: 103219
Ensembl: ENSMUSG00000036144
UniProt: P32443
Position
12:37158539..37229533
AA seq 303 aa
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGPPELG
SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPADVEKRSGSKRKSDSSDSQEGNYKS
EVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK
WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANEDSRDSDHSSEH
AHL
NT seq 912 nt   +upstreamnt  +downstreamnt
atggaacaccccctctttggctgcctgcgcagcccccacgccacagcgcaaggcttgcac
cccttctcccagtcttctctggccctccatggaagatctgaccacatgtcctaccccgaa
ctctccacatcttcctcgtcttgcataatcgcgggataccccaacgaggagggcatgttt
gccagccagcatcacagggggcaccaccaccaccaccaccatcaccatcaccaccaccag
cagcagcagcaccaggctctgcaaagcaactggcacctcccgcagatgtcctctccacca
agcgcggcccggcacagcctgtgcctgcagcctgattcgggagggcccccggagctggga
agcagccctccggtcctgtgttccaactcatctagcctgggctccagcacccctaccggg
gccgcgtgcgcaccaggggattatggccgtcaagcgctgtcacccgcagacgtagagaag
agaagtggcagcaaaaggaaaagcgacagctcagattcccaggaaggaaactacaagtca
gaagtgaacagcaaacctaggaaggaaagaacagcttttaccaaagagcaaatcagagaa
ctagaggcagaatttgcccatcataattatctgaccagactgagaagatatgagatagca
gtgaatctagacctcactgaaagacaggtgaaagtgtggttccagaacaggagaatgaag
tggaagcgggtcaaagggggacagcaaggagctgctgcccgagaaaaggaactggtgaat
gtgaaaaagggaacgcttcttccgtcagagctgtcaggaatcggtgcagccaccctccag
cagacaggggactcactagcaaacgaggacagccgcgatagtgaccacagctctgagcac
gcacacttatga

DBGET integrated database retrieval system