KEGG   Mus musculus (mouse): 17289Help
Entry
17289             CDS       T01002                                 

Gene name
Mertk, Eyk, Mer, Nyk, nmf12
Definition
(RefSeq) MER proto-oncogene tyrosine kinase
  KO
K05117  c-mer proto-oncogene tyrosine kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17289 (Mertk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     17289 (Mertk)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   17289 (Mertk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 Ig_2 fn3 ig I-set V-set C2-set_2 TMEM132D_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 17289
NCBI-ProteinID: NP_032613
MGI: 96965
Ensembl: ENSMUSG00000014361
Vega: OTTMUSG00000015353
UniProt: Q60805
Position
2; 2 F1
AA seq 994 aa AA seqDB search
MVLAPLLLGLLLLPALWSGGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLP
PPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQET
AGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIV
SDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERS
PSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWV
PGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEI
GWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHV
WESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSK
VDYAPSSTPAPGNTDSMFIILGCFCGFILIGLILCISLALRRRVQETKFGGAFSEEDSQL
VVNYRAKKSFCRRAIELTLQSLGVSEELQNKLEDVVIDRNLLVLGKVLGEGEFGSVMEGN
LKQEDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDFNHPNVIRLLGVCIELSSQGIP
KPMVILPFMKYGDLHTFLLYSRLNTGPKYIHLQTLLKFMMDIAQGMEYLSNRNFLHRDLA
ARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWA
FGVTMWEITTRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYDIMYSCWSADPLDRP
TFSVLRLQLEKLSESLPDAQDKESIIYINTQLLESCEGIANGPSLTGLDMNIDPDSIIAS
CTPGAAVSVVTAEVHENNLREERYILNGGNEEWEDVSSTPFAAVTPEKDGVLPEDRLTKN
GVSWSHHSTLPLGSPSPDELLFVDDSLEDSEVLM
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggttctggccccactgctactggggctgctgctgctacccgcgctctggagtggaggc
actgccgagaagtgggaagagaccgagctagatcagctattttcagggcctttaccaggg
agactcccagtcaaccacaggccattctctgctcctcactccagccgggaccagctgcca
ccaccccagactggaagatcacatccagcacacacagccgctccccaggtgacctccaca
gcatcaaagctcctacctcctgttgcgtttaatcacaccattggacacatagtactgtcg
gaacataaaaatgtcaaatttaattgctccatcaatattcctaacacataccaagaaaca
gctggcatttcatggtggaaagatggaaaggaattgctcggggcacatcattcaatcaca
cagttttatcctgatgaggaaggggtatcaataattgcattgttcagcatagccagtgtg
cagcgctcagacaatgggtcgtacttctgtaagatgaaggtgaacaatagagagattgta
tctgatcccatatacgtggaagttcaaggactcccttactttattaagcagcctgagagt
gtgaatgtcaccagaaacacagccttcaacctcacctgccaggccgtgggccctcctgag
cccgtcaatatcttctgggttcaaaatagcagccgtgttaatgaaaaaccggaaaggtcc
ccgtctgtcctaaccgtacctggtctgacagagacagcagtcttcagctgtgaggcccac
aatgacaaaggactgacggtgtccaagggtgtacatatcaacatcaaagtaatcccctcc
ccgcccactgaagtccatatcctcaacagtacagcacacagcatcctggtctcctgggtc
cctggttttgatggctactccccacttcagaactgcagcattcaggtcaaggaagctgac
cggctgagtaatggctcagtcatggtttttaatacctctgcttcgccacatctgtatgag
atccagcagctgcaagccctggctaattacagcatcgctgtgtcctgtcggaatgagatt
ggctggtctgcagtaagcccttggattctggccagcacaacagaaggagctccatctgta
gcacctttaaacatcactgtgtttctgaacgaatctaacaatatcctggatattagatgg
acgaagcctccaattaagcggcaggatggggaactggtgggctaccggatatctcacgtg
tgggaaagcgcagggacttacaaagagctttctgaagaagtcagccagaatggcagctgg
gctcagattcctgtccaaatccacaatgccacctgcacagtgagaatcgcggccattact
aaagggggcatcgggcccttcagtgagccagtgaatatcatcattcctgaacacagtaag
gtagattacgcaccctcgtcaaccccagcccctggcaacaccgactctatgttcatcatc
ctcggctgcttctgtggattcattttaatcgggttaattttgtgtatttctctggccctc
agaaggagagtccaggaaacaaagtttgggggagcattctctgaggaggattcccaactg
gtcgtaaattatagagcgaagaagtccttctgccggcgagccatcgagcttaccttgcag
agcctgggagtgagcgaggagctgcagaataagctggaagatgttgtgattgacagaaac
cttctggttctcggcaaagttctgggtgaaggagagtttgggtctgtaatggaaggaaat
ttgaagcaagaagatgggacttctcagaaggtggcagtgaagaccatgaagttggacaac
ttttctcaacgggagatcgaggagtttctcagcgaagcagcatgcatgaaagacttcaac
cacccaaatgtcatccgacttctaggcgtgtgtatagaactgagctctcaaggcatcccg
aagcccatggtgattttacccttcatgaaatacggagacctccacaccttcctgttatat
tcccgattaaacacaggacccaagtacattcacctgcagacactactgaagttcatgatg
gacattgcccagggaatggagtatctgagcaacaggaattttcttcatagggatttggca
gctcgaaactgcatgttgcgggatgacatgactgtctgcgtggcagactttggcctctca
aagaagatttacagtggtgattattaccgccaaggccgcattgccaaaatgcctgtgaag
tggatcgccatcgagagcctggcggaccgagtctacacaagcaaaagtgacgtgtgggct
tttggcgtgaccatgtgggaaataacaacacggggaatgactccctatcccggagttcag
aaccatgagatgtacgactaccttctccacggccacaggctgaagcagcctgaggactgc
ttggatgaactgtatgacatcatgtactcttgctggagtgctgatcccttggatcgaccc
accttctctgtgttgaggctgcagctggaaaagctctccgagagtttgcctgatgcgcag
gacaaagaatccatcatctacatcaatacccagttgctagagagctgcgagggcatagcc
aatgggccctcactcacggggctagacatgaacattgaccctgactccatcattgcctct
tgcacaccaggcgctgccgtcagcgtggtcacggcagaagttcacgagaacaaccttcgt
gaggaaagatacatcttgaatgggggcaatgaggaatgggaagatgtgtcctccactcct
tttgctgcagtcacacctgaaaaggatggtgtcttaccggaggacagactcaccaaaaat
ggcgtctcctggtctcaccatagtacactacccttggggagcccatcaccagatgaactt
ttatttgtagatgactccttggaagactctgaagttctgatgtga

DBGET integrated database retrieval system