KEGG   Mus musculus (mouse): 17300Help
Entry
17300             CDS       T01002                                 

Gene name
Foxc1, FREAC3, Fkh1, Mf1, Mf4, ch, fkh-1, frkhda
Definition
(RefSeq) forkhead box C1
  KO
K09396  forkhead box protein C
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17300 (Foxc1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    17300 (Foxc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 17300
NCBI-ProteinID: NP_032618
MGI: 1347466
Ensembl: ENSMUSG00000050295
Vega: OTTMUSG00000000725
UniProt: Q61572
Position
13 A3.2; 13 13.52 cM
AA seq 553 aa AA seqDB search
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGSM
ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQ
GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAV
KDKEEKGRLHLQEPPPPQAGRQPAPAPPEQAEGSAPGPQPPPVRIQDIKTENGTCPSPPQ
PLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDAAEPAPPPQPAP
PPHHSQGFSVDNIMTSLRGSPQGSAAELGSGLLASAAASSRAGIAPPLALGAYSPGQSSL
YSSPCSQSSSAGSSGGGGGGGGGGGGSSSAAGTGGAATYHCNLQAMSLYAAGERGGHLQG
PAGGAGSAAVDDPLPDYSLPPATSSSSSSLSHGGGGQEASHHPASHQGRLTSWYLNQAGG
DLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPASQSLY
RTSGAFVYDCSKF
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgcgctactcggtgtccagccccaactccctgggagtggtgccctacctcggc
ggcgagcagagctactatcgcgctgccgcggcggcggccgggggcggctacaccgccatg
ccggcccctatgagcgtgtactcgcaccctgctcacgccgagcagtacccgggcagcatg
gcgcgcgcctacgggccttatacgccgcagccgcagcccaaggacatggtgaagccgccc
tacagctacatcgctcttatcaccatggccatccagaatgccccggacaagaagatcact
ctgaatggcatctaccagttcatcatggaccgcttccccttctatcgggacaataagcag
ggctggcagaacagcatacggcacaacctctcgctcaacgagtgcttcgtcaaggtgccc
cgcgacgacaagaagccaggcaagggcagctactggacgctcgacccggactcctacaac
atgttcgagaacggcagcttcctgcggcggcggcggcgcttcaagaagaaggacgcagtg
aaggacaaggaggagaagggccggctgcacctccaagaaccgccaccgccgcaggccggc
cgccagcccgcgcccgcgcccccggagcaggccgagggctccgctcccgggccacagccg
ccgcccgtgcgcatccaggacatcaagacggagaacggtacgtgtccctcgcctccccag
cccctgtccccggctgccgccctaggcagcggcagcgccgccacagtgcccaaaatcgag
agccccgacagcagcagcagcagcttgtcgagcgggagcagccccccgggcagcctgccg
tcggcgcggccgctcagcctggacgctgcagaacccgcgccgccgccacagcctgcgccg
ccgccgcatcacagccagggcttcagcgtggacaacatcatgacgtcgctgcgggggtcg
ccgcagggttcggccgctgagctcggttccggcctcctggcctcggcggctgcgtcctcg
cgcgcgggcatcgcgcccccgctggcgctgggtgcctactctccgggccagagctccctc
tacagctccccctgcagccagagctccagtgcgggcagttcgggcggcgggggtggcggc
ggcggcggaggcggcggcagcagcagcgctgcgggtacggggggcgccgccacttaccac
tgcaacctgcaggctatgagcctgtacgcggcgggcgagcgtggcggccacttgcagggt
ccggcgggaggcgcgggcagcgcggcggtggacgaccccctgcccgactactcgctgcct
ccagcgaccagcagcagctcttcgtccctgagtcatggcgggggcggccaggaggccagc
caccaccctgcatcccaccagggccgactcacctcgtggtacctgaaccaggcaggtgga
gacctgggccacttggcgagcgcggcggcggctgcggcggccgcaggctaccctggccag
cagcagaacttccactcggtgcgggaaatgttcgagtctcagcggatcggcttgaacaac
tccccggtgaatgggaatagtagctgtcagatggctttccctgccagtcagtctctgtac
cgcacgtcgggggctttcgtctatgactgtagcaaattctga

DBGET integrated database retrieval system