KEGG   Mus musculus (mouse): 17306
Entry
17306             CDS       T01002                                 

Gene name
Sypl2, AI552439, Mg29
Definition
(RefSeq) synaptophysin-like 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 17306
NCBI-ProteinID: NP_032622
MGI: 1328311
Ensembl: ENSMUSG00000027887
Vega: OTTMUSG00000007181
UniProt: O89104
Position
3; 3 F2.3- F3
AA seq 264 aa
MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET
GALVLCNNEAKDVSSIIVLFGYPFRLYQVQYEMPLCDQDSTSKTMNLMGDFSAPAEFFVT
LGIFSFFYTMAALVIYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG
ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANLSVLFGFINFFLWAGNCWFVFKETPWH
GQGQDQGQGPSQESAAEQGAVEKQ
NT seq 795 nt   +upstreamnt  +downstreamnt
atgtcctcgacggagagccccggccgcacctcggacaagtctccgcgccagcaggtggac
cgcctgctcctggggctgcgctggcagcgcctggaggagccgctgggcttcatcaaagtt
ctccagtggctctttgctattttcgccttcgggtcctgcggctcttacagcggggagacg
ggagccttggttctctgcaacaacgaagccaaggacgtgagctccatcattgttttgttc
ggctatcccttcaggttgtaccaggtccagtatgagatgcctctctgtgatcaggactcc
acctccaaaaccatgaacctcatgggagacttctctgcccccgccgagttctttgtgacc
cttggcatcttttccttcttctacacaatggctgccctggtcatctacctgcgcttccac
aaactctacacagagaacaaacgcttcccgttggtggatttctgtgtgactgtctctttc
accttcttttggctggttgctgccgctgcctggggcaagggcttgactgacgtcaaaggg
gccacccggccatccagcctgactgcagccatgtctgtgtgccatggagaggaggcagtg
tgcagcgccggggccacaccctctatggggctggctaacctctctgtgctctttggcttt
atcaacttcttcctgtgggctggaaactgttggtttgtgttcaaagagaccccgtggcac
ggacaaggccaggaccagggccagggccccagccaggagagtgcagcggagcagggggca
gtggagaagcagtaa

DBGET integrated database retrieval system