KEGG   Mus musculus (mouse): 17314Help
Entry
17314             CDS       T01002                                 

Gene name
Mgmt, AGT, AI267024, Agat
Definition
(RefSeq) O-6-methylguanine-DNA methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17314 (Mgmt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     17314 (Mgmt)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   Direct repair
    17314 (Mgmt)
 Prokaryotic Type
    17314 (Mgmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_binding_1 Methyltransf_1N
Motif
Other DBs
NCBI-GeneID: 17314
NCBI-ProteinID: NP_032624
MGI: 96977
Ensembl: ENSMUSG00000054612
Vega: OTTMUSG00000060300
UniProt: P26187 Q4VA39
Position
7 F3; 7 82.07 cM
AA seq 211 aa AA seqDB search
MAETCKMKYSVLDSPLGKMELSGCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVP
EPLVQCTAWLEAYFREPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQ
LAALAGNPKAARAVGGAMRSNPVPILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHEGIP
TGQPASKGLGLTGTWLKSSFESTSSEPSGRN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacctgcaaaatgaaatactcagtgttggacagccctttggggaagatggag
ctgtctggctgtgagcgaggcctgcatgggatacggttgctcagtgggaagaccccaaac
actgaccccacagaggccccagctactcctgaggtgctcggtgggccagagggagttcca
gagcctctggtgcagtgcacagcctggctggaagcctatttccgtgaacccgcagccaca
gaggggcttcccttgcctgctctccatcaccctgtgttccagcaagattcattcaccaga
caggtgttatggaagctgctgaaggttgtgaaattcggagaaacggtttcttaccagcaa
ttagcagccctggcaggcaaccccaaagcggctcgtgcagtaggaggagcaatgagaagc
aatccggtccccatcctcatcccctgccacagggtggttcgcagtgacggtgccatcggc
cattactccggaggagggcaggctgtgaaggagtggcttctggcccatgagggcatcccg
accggacagccagcctccaagggcttgggtctgactgggacctggctcaagtcatccttc
gagtcgaccagctctgagccgtctggccgaaattga

DBGET integrated database retrieval system