KEGG   Mus musculus (mouse): 17329
Entry
17329             CDS       T01002                                 

Gene name
Cxcl9, BB139920, CMK, Mi, Mig, MuMIG, Scyb, Scyb9, crg-1, crg-10
Definition
(RefSeq) chemokine (C-X-C motif) ligand 9
  KO
K05416  C-X-C motif chemokine 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    17329 (Cxcl9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    17329 (Cxcl9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    17329 (Cxcl9)
   04062 Chemokine signaling pathway
    17329 (Cxcl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    17329 (Cxcl9)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   17329 (Cxcl9)
SSDB
Motif
Pfam: IL8 Rtf2
Other DBs
NCBI-GeneID: 17329
NCBI-ProteinID: NP_032625
MGI: 1352449
Ensembl: ENSMUSG00000029417
Vega: OTTMUSG00000055603
UniProt: P18340
Position
5 E2; 5 46.51 cM
AA seq 126 aa
MKSAVLFLLGIIFLEQCGVRGTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKT
EIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRR
RSRKTT
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaagtccgctgttcttttcctcttgggcatcatcttcctggagcagtgtggagttcga
ggaaccctagtgataaggaatgcacgatgctcctgcatcagcaccagccgaggcacgatc
cactacaaatccctcaaagacctcaaacagtttgccccaagccccaattgcaacaaaact
gaaatcattgctacactgaagaacggagatcaaacctgcctagatccggactcggcaaat
gtgaagaagctgatgaaagaatgggaaaagaagatcagccaaaagaaaaagcaaaagagg
gggaaaaaacatcaaaagaacatgaaaaacagaaaacccaaaacaccccaaagtcgtcgt
cgttcaaggaagactacataa

DBGET integrated database retrieval system