KEGG   Mus musculus (mouse): 17330Help
Entry
17330             CDS       T01002                                 

Gene name
Minpp1, AA408516
Definition
(RefSeq) multiple inositol polyphosphate histidine phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    17330 (Minpp1)
   00562 Inositol phosphate metabolism
    17330 (Minpp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     17330 (Minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     17330 (Minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 17330
NCBI-ProteinID: NP_034929
MGI: 1336159
Ensembl: ENSMUSG00000024896
UniProt: Q9Z2L6
Position
19 C1; 19 27.25 cM
AA seq 481 aa AA seqDB search
MLRGARSHLPASVAPAAVLAAALLSSFARCSLPGRGDPVASVLSPYFGTKTRYEDANPWL
LVDPVAPRRDPELLAGTCTPVQLVALIRHGTRYPTTKQIRKLKQLQGLLQTRESRDGGSQ
VAAALAEWPLWYGDWMDGQLVEKGRQDMRQLALRLAALFPDLFSRENYDRLRLITSSKHR
CVDSSAAFLQGLWQHYHPGLPPPDVSDMECGPPRINDKLMRFFDHCEKFLTDVERNETAL
YHVEAFKTGPEMQKVLKKVAATLQVPMNSLNADLIQVAFFTCSFDLAIKGVHSPWCDVFD
VDDARVLEYLNDLKQYWKRSYGYTINSRSSCNLFQDIFLHLDKAVEQKQRSQPVSSPVIL
QFGHAETLLPLLSLMGYFKDKEPLTAYNFEEQVNRKFRSGHIVPYASNLIFVLYHCDNAQ
SPEEQFQIQLLLNEKVLPLAHSQRPVGLYEELKTHYRDILQSCQTSKECSPPKANITSDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcggcgcgcgcagccacctcccggcctcggtagcgcccgccgcggtcctggct
gcggcgctgctctcgtcgttcgcgcgctgctctctcccggggcgcggcgacccggtggct
tcggtgctcagcccctacttcggcacgaagacacgctacgaagatgccaacccctggctg
ctggtcgatccggtggcgccgcggcgggacccggagctgctggcggggacctgcaccccg
gtgcagctggtcgccctcatccgtcacggcacccgctaccctacgaccaagcagatccgc
aagctgaagcagctgcaggggctgctgcagacccgcgagtcccgggatggcgggagccaa
gtggccgccgcgctggccgagtggccgctgtggtacggtgactggatggacgggcagctg
gtggagaaggggcggcaggacatgcgacagctggccctgcgtctggctgccctcttccca
gacctcttcagccgggagaactacgaccgcctgcggctgatcaccagctccaagcaccgc
tgtgtggacagcagcgccgccttcctccaggggttgtggcagcattaccacccaggactg
ccacctcccgacgtctcagatatggagtgtggccctccaagaattaatgataaactaatg
aggttcttcgatcattgtgagaagttcttaactgatgtggaaagaaacgagacggctctt
tatcatgtggaagctttcaaaactggaccagaaatgcagaaggtcttaaagaaagttgca
gctactctgcaagtgccaatgaacagtttaaatgcagacttaattcaggtagcttttttc
acctgttcatttgacctggcaattaaaggtgtccattctccctggtgtgatgtgtttgac
gtagatgatgcaagggttctggaatacttaaacgacctgaaacagtactggaaacgaagc
tatggctacaccattaacagccggtccagctgcaacctatttcaggacatttttctacac
ctggacaaagcagtggagcagaagcaaaggtctcagccagtctcctctccagtcatcctc
cagtttggacacgcggagacgctcctgccgctcctctccctcatgggctacttcaaggac
aaggagcctctgaccgcttacaatttcgaggagcaagttaatcgcaagttccgaagtggt
cacatcgtaccttatgcctcaaacctaatcttcgtgctttaccactgtgacaacgcgcag
agccccgaagaacaattccagatacagctgctgctgaatgagaaggtgctgcccctggct
cactcgcagagacccgtcgggttgtatgaggagctcaagacccactaccgggacattctt
cagagctgccaaaccagtaaggagtgcagcccgcccaaagcgaacatcacgtccgatgag
ctctga

DBGET integrated database retrieval system