KEGG   Mus musculus (mouse): 17339
Entry
17339             CDS       T01002                                 

Gene name
Mip, Aq, Aqp0, Cat, Ct, Cts, Hfi, Lop, MIP26, MP26, Svl, shri, shrivelled
Definition
(RefSeq) major intrinsic protein of lens fiber
  KO
K09863  aquaporin-0
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    17339 (Mip)
Transporters [BR:mmu02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    17339 (Mip)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 17339
NCBI-ProteinID: NP_032626
MGI: 96990
Ensembl: ENSMUSG00000025389
Vega: OTTMUSG00000024337
UniProt: P51180
Position
10 D3; 10 76.49 cM
AA seq 263 aa
MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALATLVQTVG
HISGAHVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNT
LHAGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTG
AGMNPARSFAPAILTRNFSNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGA
RPSDSNGQPEGTGEPVELKTQAL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtgggaacttcggtctgcctccttttggagggccatatttgctgagttctttgccacc
ctcttctatgtcttctttgggcttggagcctcgctacgttgggcccctgggcccctacat
gtcttgcaagtggctttggcctttggcctggccttggctacattggtgcagactgtgggt
cacatcagtggagcccatgtcaaccctgcggtcacttttgccttccttgtgggctcccag
atgtccttgctccgggctttctgctatatagcagcccagcttctgggagctgtggctggg
gcggctgtgctgtacagtgtcaccccaccagctgtccgaggaaacctagcgctcaacacg
ctgcatgctggggtgagcgtgggccaggccaccactgtggagatcttcttgacgctccag
ttcgtgctctgcatctttgctacatacgacgagaggcggaatggccgcatgggctctgta
gccctggctgttggcttctccctcaccctggggcacctctttgggatgtattacactggt
gcggggatgaacccagcccgctcctttgctcctgccatcctcacccggaacttcagcaac
cactgggtgtactgggtgggcccgatcatcggagggggcctgggcagcctactctatgac
tttctcctcttcccccggctcaagagtgtttctgagagactgtctatcctgaagggagcc
agacccagtgactccaatggacagccagagggtacaggggaacctgtcgaactgaagact
caggccctgtaa

DBGET integrated database retrieval system