KEGG   Mus musculus (mouse): 17341
Entry
17341             CDS       T01002                                 

Gene name
Bhlha15, 1810009C13Rik, Bhlhb, Bhlhb8, MIST-1, Mis, Mist1
Definition
(RefSeq) basic helix-loop-helix family, member a15
  KO
K08040  class B basic helix-loop-helix protein 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    17341 (Bhlha15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17341 (Bhlha15)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    17341 (Bhlha15)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 17341
NCBI-ProteinID: NP_034930
MGI: 891976
Ensembl: ENSMUSG00000052271
Vega: OTTMUSG00000025580
UniProt: Q9QYC3
Position
5; 5 G2
AA seq 197 aa
MKTKNRPPRRRTPMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRR
QGSGGRRENSVQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNY
IKSLTATILTMSSSRLPGLEAPGPAPGPKLYQHYHHQQQQQQQQQQVAGAMLGVTEDQPQ
GHLQRYSTQIHSFREGS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaagaccaaaaaccggccccctcggcgccgaacacccatgcaggacacagaagccacc
ccaggagagcagacacctgacagaccccagtcaggctcaggggggtcagagctgacaaag
ggtctccggagcaggacagcgcgtgcaagcggaggtcggggagaggtcagccgccggcga
caggggtctggtggccgcagggagaacagtgttcagaggcggctggagagcaatgagcga
gagaggcagcggatgcataaactcaacaatgccttccaggcactgcgcgaggtcatcccg
cacgtgcgggctgacaagaagctctccaagatcgagaccctcacgctggccaagaactat
atcaagtcgctgaccgccaccatacttactatgtccagcagccgcctcccggggctggag
gcaccaggtcctgcgccaggccctaaattataccagcactaccatcaccagcagcagcaa
cagcagcagcagcagcaggtagctggggccatgcttggtgtcactgaggaccagccccaa
ggccacctgcaacgctactctacacagatccacagcttcagagaggggagctag

DBGET integrated database retrieval system