KEGG   Mus musculus (mouse): 17344
Entry
17344             CDS       T01002                                 

Gene name
Pias2, AI462206, ARIP3, AU018068, DIP, Di, Dib, Miz, Miz1, PI, PIAS, PIASxalpha, PIASxalpha6, PIASxb, PIASxbeta, SIZ2
Definition
(RefSeq) protein inhibitor of activated STAT 2
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    17344 (Pias2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    17344 (Pias2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    17344 (Pias2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     17344 (Pias2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   17344 (Pias2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 17344
NCBI-ProteinID: NP_032628
MGI: 1096566
Ensembl: ENSMUSG00000025423
UniProt: Q8C5D8 Q3V3U5
Position
18; 18 E3
AA seq 621 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLCDLSTIKSSVFSLDGSSSPVEPDLPVAGIHSLPSTSITPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
VSSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSS
RSETGVITSSGRNIPDIISLD
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggcggatttcgaggagttgaggaatatggtttctagttttagggtttctgagttacaa
gtgttactgggctttgctggacggaataaaagtgggcgcaagcatgacctcctgatgagg
gcgttgcatttattgaagagtggctgcagccctgcggttcagattaaaattcgagaatta
tatagacgccgatacccacggacacttgaaggactttgtgatctttccacaatcaaatca
tcggttttcagcttggatggtagctcatcacccgtagaacctgacttgcctgtggctggg
atccactcgttgccttcgacttcaattacacctcattcaccgtcatctcctgttggttct
gtactgctgcaagacactaagcccacctttgagatgcagcagccgtctccgcccattcct
cctgtccatcctgatgtgcagttaaaaaacctgcctttctatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcggtttcaagagaagttttttatt
tttgctttgacacctcagcaagttagagaaatatgtatttcaagggactttttgccgggt
ggcaggagagactacacagtccaagtccagctgcgactttgcttggcagagaccagttgc
cctcaagaagataactatcccaatagtttgtgtataaaagtcaatgggaaactctttcct
ttgcctggctatgcgccaccacctaaaaatgggattgaacagaagcgccctggacgcccc
ctgaacattacgtctttagttaggttgtcttcagctgtgccaaatcagatttctatttct
tgggcatctgaaattggaaagaattactccatgtctgtgtatcttgtacgacagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaatcctgatcattccaga
gcactaattaaagaaaaacttactgcagaccctgatagtgaaattgctacaactagtctt
cgagtgtccttgatgtgccctttaggaaaaatgaggctgacaatcccgtgccgtgcagtg
acttgtacacatctgcagtgctttgatgctgccctctatcttcagatgaatgagaaaaag
cccacctggatctgtcctgtttgtgacaaaaaggctgcctatgagagtctgatactagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaggaa
gatggttcttggtgtcccatgagacctaaaaaagaagctatgaaagtaaccagccagccc
tgtacaaaagtagaaagttcaagtgtctttagtaaaccttgttcagtgactgtagccagt
gatgcaagcaagaagaagatagatgttattgatctaacaatagagagctcttctgatgaa
gaggaagaccctcccgccaaaaggaaatgcatctttatgtcagaaacacaaagcagtcca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcagtt
gatcctgctgctattccaccttcattaacagactactcagtaccattccaccacacgcca
gtgtcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagcagt
acgtctgtcaccaccaccagcccccatgaaagcagtactcacgttagttcatccagcagc
aggagtgagacaggggtcataaccagcagtgggaggaacattcctgacatcatctctttg
gactaa

KEGG   Mus musculus (mouse): 229615
Entry
229615            CDS       T01002                                 

Gene name
Pias3, P, Pias3l
Definition
(RefSeq) protein inhibitor of activated STAT 3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    229615 (Pias3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    229615 (Pias3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    229615 (Pias3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     229615 (Pias3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   229615 (Pias3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 229615
NCBI-ProteinID: NP_001159421
MGI: 1913126
Ensembl: ENSMUSG00000028101
Vega: OTTMUSG00000034169
UniProt: O54714
Position
3; 3 F2.1
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLTPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSAVQEGIQPESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPG
SSLREGHGGPLPSGPSLTGCRSDVISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgagttaaagcacatggtgatgagtttccgagtgtctgagctccag
gtgctcctcggcttcgctggcaggaacaagagtgggcggaaacacgagctgctggccaag
gccctgcacctcctcaagtctagctgcgcccccagcgtccagatgaagatcaaagaactt
tatcgcaggcgctttccccggaagaccctggggccttctgatctctccttgctttctttg
ccccctggcacctctcctgtaggctcccccggcccccttgctcccatccctcccaccctt
ctgacccctggcaccttgctaggccctaagcgtgaggtggacatgcatcctcctctgccg
cagcctgtgcaccccgatgtcaccatgaagccactgcccttctatgaagtctatggggag
ctcatccgacccaccacccttgcgtccacctccagccagaggttcgaggaagcccacttc
accttcgcgctcactccccagcagctgcagcagattctcacgtccagggaggttctgcca
ggagccaagtgtgattacaccatacaagtgcagctcagattctgtctctgtgagaccagc
tgccctcaggaggactatttcccccctaacctctttgttaaggttaatgggaaactctgc
cccctgccgggttacctccctccaaccaagaatggagctgagcccaagaggcccagccgt
ccgatcaacatcacacccttggctcgactctcagccactgtccccaacaccatcgtagtt
aattggtcatctgagtttggacggaattactccttgtccgtgtacctggtgaggcaattg
actgcagggacccttctacaaaaactcagagccaaggggatccggaatccagaccattcc
cgggcactgatcaaggagaaactgactgctgaccccgacagtgaagtggctactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccgtgtcgtgcc
ctcacctgtgcccatctgcagagtttcgatgctgccctttatctacagatgaatgagaag
aagccgacatggacgtgtcctgtgtgtgacaagaaggctccctatgagtcgctgattatt
gatggtttattcatggaaattcttaattcctgttcggattgtgatgagatccagttcatg
gaagatggatcctggtgtccgatgaaacccaagaaggaggcatcagaggtttgccccccg
ccagggtatgggctggatggtctccagtacagcgcagtccaggagggaattcagccagag
agtaagaagagggtcgaagtcattgacttgaccatcgaaagctcatcagatgaggaggat
ttgccccccaccaagaagcactgccctgtcacctcagcggccattccagcccttcctgga
agcaaaggagccctgacctctggtcaccagccatcctcggtgctgcggagccctgcaatg
ggcacactgggcagtgacttcctgtctagtctcccgctacatgagtacccacctgccttc
ccactgggggctgacatccaaggtttagatttattttctttccttcagactgagagtcag
cactacggcccttcagttatcacttcgctagatgaacaggacacccttggccacttcttc
cagtaccggggaaccccttcccacttcctgggcccactggcccccacactggggagctct
caccgcagctccactccagcgccccctcctggtcgtgtcagcagcattgtggctcctggg
agctccttgagggaagggcatggaggacccctgccttcaggtccctctttgactggctgt
cggtcagacgtcatttccttggactga

KEGG   Mus musculus (mouse): 56469
Entry
56469             CDS       T01002                                 

Gene name
Pias1, 2900068C24Rik, Ddxbp, Ddxbp1, GB, GBP
Definition
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04630  JAK-STAT signaling pathway
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    56469 (Pias1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    56469 (Pias1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    56469 (Pias1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56469 (Pias1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    56469 (Pias1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     56469 (Pias1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   56469 (Pias1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    56469 (Pias1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse FAM53
Other DBs
NCBI-GeneID: 56469
NCBI-ProteinID: NP_062637
MGI: 1913125
Ensembl: ENSMUSG00000032405
Vega: OTTMUSG00000062567
UniProt: O88907 Q2M4G9
Position
9; 9 B
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPPTLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVTASYNGVDGCLSSTLEHQVASHNQSSNKNKKVEVIDLTIDSSSDEEEEEPPAKRT
CPSLSPTSPLSNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPATNGSSSGSNSSLVSSNSLRESHGHGVASRSSADTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggaggaacaagcacggacgcaaacacgaacttcttacaaaa
gccctgcatttgttaaaggctggctgtagtcctgctgtacaaatgaaaattaaagaactc
tacaggaggcggttccctcagaaaattatgacgcctgcggacttgtctatccccaacgta
cattcaagtcctatgcctccgactctttctccatccaccattccacagctcacttatgat
ggccaccctgcatcatccccactactccctgtttctcttctgggacccaaacatgaactg
gaactcccacatctcacgtcagcgctgcacccagtccacccggacataaagctgcagaag
ctaccattctatgacctgttggatgaactgatcaagcccaccagtctagcttcagacaac
agccagcgctttcgggaaacctgttttgcatttgccttgacaccacaacaggtgcagcag
atcagcagctccatggatatttctgggaccaaatgtgacttcacagtgcaggtccaatta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaacctttgt
gtaaaagtgaatacaaaaccttgcagccttccaggttaccttccacctactaaaaacggt
gtggaaccaaagcgacctagccgaccaattaatatcacctcacttgtccgattgtccacg
acagtaccaaataccattgttgtttcttggactgcagaaattggaagaacctattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttaactgcagatcca
gatagtgagatagctactaccagcctacgggtttcgctgctgtgtccacttgggaaaatg
cgactgacaatcccctgtcgggcacttacctgctcccaccttcagtgttttgatgcaact
ctttacattcaaatgaatgagaaaaaaccaacatgggtttgtcctgtctgtgataagaag
gccccatatgaacaccttattattgacgggttgtttatggaaattctaaagtactgcaca
gactgtgacgagatacagtttaaggaggatggctcgtgggctccaatgaggtcaaagaag
gaggttcaagaagtcactgcctcctacaatggagttgatggttgcttgagctccacattg
gagcatcaggtagcgtcccacaaccagtcctcaaataaaaacaagaaagtcgaggtcatt
gacctaaccattgacagctcgtcagatgaagaggaggaagaaccccctgccaagaggacc
tgtccttccctgtctcctacgtcaccactaagtaataaaggcattttaagtcttcctcat
caagcctcgcctgtgtcccgcaccccaagccttcctgctgtagatacaagctacatcaac
acctccctcatccaggactacaggcaccccttccacatgacgcctatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccctg
ctagccgcagctgcagcggcggtctcagatgaccaggacctcctgcactcctcccggttt
ttcccgtatacctcctcgcagatgtttctcgaccagctaagtgcaggagggagcacatct
ctgccagccaccaacggaagcagtagcggcagcaacagcagccttgtgtcttccaacagt
ctgagagagagccatggccatggtgtggccagcaggagcagcgcagacacagcgtccatc
tttggcatcataccagacattatctcattggactga

KEGG   Mus musculus (mouse): 59004
Entry
59004             CDS       T01002                                 

Gene name
Pias4, P, PIASY, Pias-gamma, Piasg
Definition
(RefSeq) protein inhibitor of activated STAT 4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04630  JAK-STAT signaling pathway
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    59004 (Pias4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    59004 (Pias4)
   04064 NF-kappa B signaling pathway
    59004 (Pias4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    59004 (Pias4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59004 (Pias4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     59004 (Pias4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   59004 (Pias4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse DARPP-32 SAP Sporozoite_P67 YL1 CENP-B_dimeris
Other DBs
NCBI-GeneID: 59004
NCBI-ProteinID: NP_067476
MGI: 2136940
Ensembl: ENSMUSG00000004934
Vega: OTTMUSG00000030312
UniProt: Q9JM05 Q3ULQ6
Position
10; 10 C1
AA seq 507 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSAEPGPQAPRPLDPLALHSMPRTPLSGPTVDYPVLYGKYLNGLGRLPTKTL
KPEVRLVKLPFFNMLDELLKPTELVPQSAEKLQESPCIFALTPRQVEMIRNSRELQPGVK
AVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTH
LMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSDLLQRLKTIGVKHPELCKALVKEKL
RLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPV
CDKPAAYDQLIIDGLLSKILSECEGADEIEFLAEGSWRPIRAEKEPSCSPQGPILVLGTS
DANGLAPASSTPGIGSGLSGPGSAGSGAGAAGSLENGKTGADVVDLTLDSSSSSEDEDED
EDDDEDEDEGPRPKRRCPFQKGLVPAC
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcggcagagctggtggaggccaaaaacatggtgatgagcttccgagtatcagacctg
cagatgctgctgggctttgtaggccggagcaagagtgggctgaagcacgaactggtgacc
agggccttgcagctggtgcagttcgactgtagcccagagcttttcaagaagatcaaagag
ctgtatgagactcgctatgccaagaagagtgcagagcccggcccacaggcaccacggccc
ctggatcccctggcactacactccatgcccaggactcccctgtcagggcccaccgtggac
taccccgtgctgtacgggaagtacttgaatggactggggcgcctgcccaccaagaccctt
aagccggaggtacgcctggttaagctccccttcttcaacatgctggacgaattgctgaag
cccactgaactggtcccacagagtgcagagaagctgcaagagagcccatgcatcttcgcg
ctaacacctcggcaggtggagatgatccgcaactccagggagctgcagcctggagtgaaa
gctgtgcaggtggtgctgaggatctgttactctgataccagctgtccgcaggaggaccaa
tacccacccaacatcgctgtgaaggtcaaccacagctactgctcagtgccgggctactat
ccctccaacaagcctggtgtggaacctaagaggccctgccgccccatcaaccttacccac
ctcatgtatctgtcctcggccaccaaccgcattactgtcacctggggcaactatggcaag
agctactctgtggctttgtacctggtgcgacagctgacctcctcagacctgctacagagg
ttgaagacgattggggtgaagcatcctgagctgtgcaaggctttggtcaaggagaagctt
cgcctagaccccgacagcgagatcgccactaccggagtgcgagtgtccctcatctgccca
ctggtgaagatgcgcctctcggtgccctgccgtgcagagacctgcgcacacctgcagtgc
tttgatgctgtgttctacctgcaaatgaatgagaagaagcccacctggatgtgccctgtg
tgtgacaagcctgcagcctatgaccagctcatcatagatgggctgctgtcgaagatcctg
agtgagtgtgagggcgcggatgagattgagttcctggcggaaggctcatggcgtccaatc
cgtgcagagaaggagccaagctgcagcccacagggccccatcctggtgctaggcacctcg
gacgccaatgggctcgcaccagcctccagcacccccggtataggcagtggcctgagtggc
ccaggcagcgccggcagcggtgcgggggcagcaggcagcctggagaatggcaagacggga
gccgacgtggtggacctcacactggacagctcgtcgtcctcggaagatgaagatgaggac
gaggacgacgatgaggacgaggacgagggcccccggccgaagcgccgctgcccgttccag
aaaggcctggtgcccgcgtgctga

DBGET integrated database retrieval system