KEGG   Mus musculus (mouse): 17346
Entry
17346             CDS       T01002                                 

Gene name
Mknk1, 2410048M24Rik, Mnk, Mnk1
Definition
(RefSeq) MAP kinase-interacting serine/threonine kinase 1
  KO
K04372  MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17346 (Mknk1)
   04066 HIF-1 signaling pathway
    17346 (Mknk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    17346 (Mknk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17346 (Mknk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17346 (Mknk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   17346 (Mknk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 17346
NCBI-ProteinID: NP_001272417
MGI: 894316
Ensembl: ENSMUSG00000028708
Vega: OTTMUSG00000008696
UniProt: O08605 A2A8W8
Position
4; 4 D1
AA seq 415 aa
MGSSEPLPIVDSDKRRKKKRKTRATDSLPGKFEDVYQLTSELLGEGAYAKVQGAVNLQSG
KEYAVKIIEKQAGHSRSRVFREVETLYQCQGNRNILELIEFFEDDTRFYLVFEKLQGGSI
LAHIQKRKHFNEREASRVVRDVATALDFLHTKGIAHRDLKPENILCESPEKVSPVKICDF
DLGSGVKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFRDEATFYDKRCDLWSLGVVLYI
MLSGYPPFVGHCGADCGWDRGEVCRMCQNKLFESIQEGKYEFPDKDWAHISNEAKDLISK
LLVRDAKQRLSAAQVLQHPWVQGQAPERGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLS
QHEENELAEEQEALAEGLCSMKLSPPSKSRLARRRALAQAGRSRDANPCLTPAGL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggcagcagtgagccccttcccatcgtggattctgacaagaggaggaagaagaagcgt
aagacccgggccaccgactctctgccaggaaagtttgaagatgtgtaccagctgacctcg
gaattgctgggagaaggagcctatgccaaagtccagggtgctgtgaacctacagagtggg
aaggagtatgctgtcaaaatcatcgagaagcaagccgggcacagtcgaagtcgagtgttc
cgtgaggtggagacactgtatcagtgtcaagggaacaggaacattttggagctgattgaa
ttctttgaagatgacacacggttttacttggtctttgagaaattgcaaggaggctccatc
ctagcacacatccagaagcggaagcacttcaatgagcgagaagccagtagagtggtgcgg
gacgtcgccactgcccttgacttcctgcacactaaaggcattgctcaccgtgatctgaag
ccagaaaacatactgtgtgaatctccagaaaaggtgtctccggtgaaaatttgtgacttt
gacttgggcagtggggtaaagttgaacaactcctgcactcccataaccacgccagagctg
actactccatgcggctctgcagagtatatggcacctgaggtggtggaggtctttagggac
gaggctactttctatgacaagcgctgtgacctgtggagcctgggtgtggtcctctacatc
atgctgagtggctaccccccctttgtaggtcactgtggggctgactgtggctgggaccgg
ggagaggtatgcaggatgtgccagaacaagctgtttgagagcatccaggaaggcaaatac
gagtttcctgacaaagactgggctcacatctccaacgaggccaaagacctcatctctaag
ctcctggttcgagatgcgaagcaaagactcagtgctgcccaggttctgcagcatccatgg
gtacaagggcaagctccagaaaggggactccccacgccgcaagtccttcagagaaacagc
agcaccatggacttgactctcttcgcagctgaggccattgccctgaaccgccagctgtct
cagcatgaggagaatgaactggccgaggaacaggaggccctagctgagggcctctgctcc
atgaagctgtcccctccatccaaatctcgcctggctcgaaggcgagccctggcccaggct
ggccgaagccgagatgcaaacccatgtttgacaccggcagggctctga

KEGG   Mus musculus (mouse): 17347
Entry
17347             CDS       T01002                                 

Gene name
Mknk2, 2010016G11Rik, Gprk7, Mnk, Mnk2
Definition
(RefSeq) MAP kinase-interacting serine/threonine kinase 2
  KO
K04372  MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17347 (Mknk2)
   04066 HIF-1 signaling pathway
    17347 (Mknk2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    17347 (Mknk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17347 (Mknk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17347 (Mknk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   17347 (Mknk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo zf-RRN7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 17347
NCBI-ProteinID: NP_067437
MGI: 894279
Ensembl: ENSMUSG00000020190
Vega: OTTMUSG00000054816
UniProt: Q8CDB0 Q3TPM2
Position
10; 10 C1
AA seq 459 aa
MVQKRTAELQGFHRSFKGQNPFELAFSLDLAQHRDSDFSPQCEARPDMPSSQPIDIPDAK
KRGRKKKRCRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCVNLITNQEYAVKIIEKQLG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHRRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGHCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWSHISFAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPLVLQRNSCAKDLTSFAAEAIAMNRQLAQCEEDAGQDQPVV
IRATSRCLQLSPPSQSKLAQRRQRASLSATPVVLVGDRA
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggtgcagaagagaacagccgaacttcagggcttccaccgttcgttcaaggggcagaat
cctttcgagttggccttctccttagacctcgcccagcacagggactctgacttcagccca
cagtgtgaagcccgacctgacatgccttccagccagcccattgacatcccagatgccaag
aagagaggccggaaaaagaagcgctgtcgggctactgacagcttctcaggcaggttcgaa
gatgtctatcagctgcaggaggatgtgctgggggaaggtgctcacgctcgtgtgcagacc
tgtgtcaatctcatcaccaaccaggaatatgctgtcaagatcattgagaagcagctgggc
cacatccgcagcagggtgttccgggaggtggagatgctgtaccagtgccagggacatagg
aatgttctagaactgattgagttctttgaggaggaggaccgtttctacctggtgtttgag
aagatgcgtggcggatccatcctaagccacatccatagaaggcgccactttaacgagctg
gaggccagcgtggtagtacaggacgtggccagtgccctggacttcctgcataacaaaggc
atcgcccacagggacctaaagccagagaacatcctatgtgagcaccccaaccaggtctcg
ccagtgaagatctgcgacttcgaccttggcagtggtatcaaactcaatggagactgctcc
cccatctccacaccagagctgctcaccccgtgtgggtcagctgagtacatggccccagag
gtggtggaggccttcagtgaagaggccagcatctacgacaagcgctgcgacctgtggagc
ctgggcgtcatcctctacatcctgcttagtggctacccgcccttcgtgggccactgtggc
agcgactgtggctgggaccgtggggaggcctgtcctgcctgccagaacatgctgtttgag
agcatccaggagggcaagtatgagttccctgacaaggactggtcccacatctcctttgct
gccaaagacctcatctccaagctgctggtccgagatgccaagcagaggctgagtgctgcc
caagtcctgcagcatccctgggtgcaggggtgtgccccagagaacaccctaccgacaccc
ttggttctgcagaggaacagctgtgccaaagacctcacgtcctttgcggctgaggccatc
gccatgaaccggcagctggcccagtgtgaggaggacgctgggcaggaccagcctgtggtc
atccgagctacctcacgctgcctgcagctgtccccaccctcccagtccaagctggcccag
cggcgccagagggctagcctgtcggccacccctgtggtccttgtgggggatcgcgcatga

DBGET integrated database retrieval system