KEGG   Mus musculus (mouse): 17364
Entry
17364             CDS       T01002                                 

Gene name
Trpm1, 4732499L03Rik, AI606771, LTR, Ltrpc1, Ml, Mlsn1, mela
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 1
  KO
K04976  transient receptor potential cation channel subfamily M member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    17364 (Trpm1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   17364 (Trpm1)
SSDB
Motif
Pfam: LSDAT_euk TRPM_tetra Ion_trans LSDAT_prok
Other DBs
NCBI-GeneID: 17364
NCBI-ProteinID: NP_001034193
MGI: 1330305
Ensembl: ENSMUSG00000030523
Vega: OTTMUSG00000022613
UniProt: Q2TV84
Position
7 C; 7 34.61 cM
AA seq 1622 aa
MGSMRKMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKRECIFVIPSTKDPNRCCCGQLTN
QHIPPLPSGAPSTTGEDTKQADTQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAMYIR
VSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAW
IFTGGVSTGVVSHVGDALKDHSSKSRGRLCAIGIAPWGMVENKEDLIGKDVTRVYQTMSN
PLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVV
EGGPNVVSIVLEYLKEDPPVPVVVCDGSGRASDILSFAHKYCDEGGVINESLRDQLLVTI
QKTFNYSKSQSYQLFAIIMECMKKKELVTVFRMGSEGQQDVEMAILTALLKGTNASAPDQ
LSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPVDTKATEKEKKPPTATTKGRGKGKGKK
KGKVKEEVEEETDPRKLELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPR
LEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKSFR
TLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHEL
MVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDDISQDLDNNSKD
FGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTD
MWMGRLRMRKNPGLKVIMGILIPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENVDANA
DAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDG
WPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISMFMVGAI
LRLQSQPYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLV
VLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLY
DEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRY
QLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERDRGLKLFLSDEELKKL
HEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEINERENFMKTSLQTVDL
RLSQLEELSGRMVSALENLAGIDRSDLIQARSRASSECEATYLLRQSSINSADGYSLYRY
HFNGEELLFEEPALSTSPGTAFRKKTYSFRVKDEDAKSHLDQPSNLHHTPGPSPPATPGR
SRLALEGPLSTELRPGSDPGISAGEFDPRADFKSTEAAPSLNAAGVTGTQLTVESTDSHP
LRESKLVRYYPGDPNTYKTMKSRSFVYTEGRKLVRGLSNWSAEYSSIMDQAWNATEWRCQ
VQRITRSRSTDIPYIVSEAASQDELEDEHRGSLLDPQISRSALTVSDRPEKENLLSVKPH
QTLGFPCLRSRSLHGRPRSAEPAPSKLDRAGHASSTSNLAVMSVVPEGQNTQQEKRSAET
EC
NT seq 4869 nt   +upstreamnt  +downstreamnt
atggggtccatgaggaagatgagcagctccttcaagcgtggttcaatcaagagctccaca
tcagggtcccagaagggtcagaaagcatggatagagaagacattttgcaaaagggaatgc
atctttgtaattcccagtacaaaagaccctaacagatgttgctgtggtcagctcactaac
cagcacatcccccctctgccgagtggggctcccagcacaacaggagaggacaccaagcag
gcagacacgcagtccgggaaatggtctgtcagcaaacacacccagagctacccaacagac
tcctatgggattcttgaattccagggtgggggttactccaataaagccatgtacatccga
gtctcctacgacaccaagccagattccctgctccacctcatggtgaaggactggcagctg
gagctcccgaagctcttgatatctgtgcacggaggcctccaaagcttcgagatgcagccc
aaactgaagcaggtgtttgggaaaggtctgatcaaggctgccatgaccacgggggcgtgg
atcttcaccgggggtgtgagcactggtgtcgtcagccatgtgggggatgccttgaaagac
cactcctccaagtccagaggccggctctgtgctataggaattgctccctggggcatggtg
gagaacaaggaagacctgattggaaaagatgtaacaagagtctatcagaccatgtccaac
cctctgagcaagctctctgtgctcaacaattcccacactcacttcatcttggctgacaac
ggcaccctgggcaagtatggtgctgaggtgaagcttcgaagacagctggaaaaacacatc
tccctgcagaagatcaacacaaggctgggccagggtgtacctgtcgtgggcctagtggta
gaaggtggtcctaacgtggtttctatcgtcctggagtatctcaaagaagaccctcctgtc
cctgtggtggtttgcgatggcagtggacgtgcctctgacattttgtccttcgcacacaaa
tactgcgacgaaggaggagtcataaacgagtccctgcgggaccagcttctagttaccatt
cagaaaacatttaattacagcaagtcccagtcgtatcagctgtttgcaattatcatggag
tgcatgaagaagaaagaactcgtcactgtgtttcggatgggttccgagggtcagcaagat
gtcgagatggcaattttaactgccttgctcaaaggaaccaacgcatcagctccagatcag
ctgagcttggccctggcttggaaccgggtcgacatagcgcgaagccagatcttcgtcttt
ggcccacactggccgccactgggaagcctggcccctcctgtggacaccaaagccacagag
aaggaaaagaagccacccacagccaccaccaaggggagaggaaaaggaaaaggcaagaag
aaaggcaaagtgaaagaggaagtggaggaagagacggacccccggaagcttgagctgctc
aactgggtgaatgccctggagcaagccatgctggatgctcttgtcctagatcgggtggac
tttgtaaagctcctgattgaaaacggagtgaacatgcagcatttcctcaccatcccgagg
ctggaggagctatacaacaccagactgggcccaccaaacacccttcatctgctggtgcgg
gatgtaaagaagagcaaccttccacctgattaccacatcagcctcattgatataggactg
gtgctggagtacctcatgggcggtgcctaccgctgcaactacactcggaaaagcttccgg
actctctacaacaacttgtttggccctaagaggccgaaagcacttaagcttctgggaatg
gaagatgatgaacccccagccaaaggcaagaagaaaaagaagaagaagaaagaggaagag
attgacatcgacgtggacgaccccgccgtgagtaggttccagtacccgttccatgagctc
atggtatgggccgtgctcatgaagcgccagaagatggcggtcttcctgtggcagcgtggg
gaagagtgcatggcgaaggccttggtggcctgcaagctctacaaggccatggcccacgag
tcctccgagagcgagctggtggatgacatctcccaggatctggacaacaattccaaagat
tttggccagctcgctgtggagctgttagaccagtcttacaagcacgatgagcaggttgcc
atgaaacttctgacctacgagctcaagaactggagcaactcaacctgcctgaagctggct
gtggcagccaagcaccgggacttcattgctcacacctgcagccagatgctgctgacagac
atgtggatgggaaggcttcgcatgaggaagaaccctggcctgaaggtcatcatggggatc
cttatcccacccaccatcttgtttttggaattccgtacatatgatgacttctcctatcaa
acatccaaggagaacgaagatggcaaagaaaaggaagaagagaatgtggatgcaaatgca
gatgctggctcgagaaagggggatgaggagaatgagcacaaaaagcagaggagcattccc
attggaacaaagatctgtgaattctataatgcgcccattgtcaagttctggttttacaca
atttcctacttgggctacttgctgctgttcaattatgtcatcctggtgcggatggatgga
tggccatcaccccaagaatggattgtcatctcctacattgtgagccttgcattggagaaa
atacgagagatcctcatgtcggaaccaggcaaactcagccagaaaatcaaagtgtggctc
caggagtactggaacatcacagacctcgtggccatctccatgttcatggttggggccatc
cttcgtctccagagccagccatacatgggctatggtcgggtcatctactgtgtggatatc
atcctctggtacatccgagtgttagacatctttggtgtcaacaaatatcttggtccctat
gtgatgatgattggaaagatgatgattgacatgctctactttgtggtcattatgctggtt
gtactgatgagttttggagtggctcggcaagccatcttgcatccggaggagaagccttcc
tggaaactggcccgaaacatcttctacatgccatactggatgatctacggagaggtgttt
gcagaccagatagacctctacgccatggaaatcaaccctccttgtggtgagaatctctat
gatgaggaaggcaagaggctccctccctgcatccctggtgcctggctcacacctgccctc
atggcctgttatctcctggtggccaatatcctgctggtcaacctactgattgctgttttc
aacaataccttctttgaagtcaagtcaatatccaatcaagtgtggaagttccagcgatac
cagctgatcatgacatttcatgacaggccggtcctgcccccaccaatgatcatcttaagt
cacatctatatcatcattatgcgcctcagcggtcgctgcagaaaaaagagagagggggac
caggaggagcgggaccgtgggttgaagttgttccttagcgacgaagaactgaaaaaactg
catgagtttgaggagcagtgcgtgcaggagcacttccgggaaaaggaggatgagcagcag
tcgtccagcgacgagcgcatccgggtcacaagcgagagggttgaaaatatgtcaatgaga
ttggaggaaatcaacgaaagagaaaatttcatgaaaacttctctgcagactgttgacctt
cggctctctcagctggaggagctatctggcaggatggtgagcgctctggagaatctggca
ggcatcgacaggtctgatctgatccaggctcgatctcgagcatcctccgaatgcgaggcc
acctacctgctgcggcagagcagcatcaacagtgccgacggctacagcttgtaccgctac
catttcaatggcgaggagcttctgtttgaggagcctgctctctccacttcgccagggaca
gcgttccggaaaaaaacctactcctttcgtgtgaaggatgaggatgcaaagtcgcacctg
gaccagcccagcaacctgcaccacacccctggccccagcccacctgccacgccaggccgc
agccggctcgcccttgaaggtcccttgagcacagagctgagacctggatcggaccctggc
atctccgcaggcgagttcgatccgcgggcggatttcaagagcacggaagctgcaccaagt
ctgaacgcagcgggtgttacaggcactcaactgactgtcgaaagcaccgattcccaccct
ctgcgggagagcaaactcgtgcgctactaccccggagaccctaacacctacaaaacaatg
aagtccagaagcttcgtctatactgaaggaagaaagctagtccgaggtcttagcaactgg
agtgcagagtacagttcaatcatggaccaagcatggaacgcgacagaatggagatgtcaa
gttcaaaggatcacgcgctcccgcagcacagacatcccatacatcgtgtccgaagcagcc
tcgcaagacgagcttgaagatgagcacagaggatctcttctggatcctcagatctcccgt
tcagccctcaccgtctccgacaggccagaaaaggaaaacttactctctgtgaagccacat
cagactttaggattcccctgcctacggtcaagaagtttacatggccgtcctaggagtgct
gagcccgctcctagcaaattagacagggcaggacatgccagcagcactagcaacttagca
gttatgtcagttgttccagagggacaaaacacccagcaagagaaaagaagcgcggaaact
gagtgctga

DBGET integrated database retrieval system