KEGG   Mus musculus (mouse): 17380Help
Entry
17380             CDS       T01002                                 

Gene name
Mme, 6030454K05Rik, C85356, CALLA, CD10, NEP, SFE
Definition
(RefSeq) membrane metallo endopeptidase
  KO
K01389  neprilysin [EC:3.4.24.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04640  Hematopoietic cell lineage
mmu04974  Protein digestion and absorption
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    17380 (Mme)
  09152 Endocrine system
   04614 Renin-angiotensin system
    17380 (Mme)
  09154 Digestive system
   04974 Protein digestion and absorption
    17380 (Mme)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17380 (Mme)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17380 (Mme)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    17380 (Mme)
   04090 CD molecules [BR:mmu04090]
    17380 (Mme)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.11  neprilysin
     17380 (Mme)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M13: neprilysin family
   17380 (Mme)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   17380 (Mme)
CD molecules [BR:mmu04090]
 Proteins
  17380 (Mme)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13 CRAL_TRIO_2
Motif
Other DBs
NCBI-GeneID: 17380
NCBI-ProteinID: NP_001276391
MGI: 97004
Ensembl: ENSMUSG00000027820
Vega: OTTMUSG00000051889
UniProt: Q61391
Position
3 E1; 3 29.97 cM
AA seq 750 aa AA seqDB search
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILKD
VLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPDIYGWPVASDNWDQTYGT
SWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELEKEIANATTKPEDRNDPMLLY
NKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQNEEEVVVYAPEYLTKLKPILT
KYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERI
GYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGIGQAYR
AYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFADAFHCRKNSYMNPERKCRVW
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggaagatcagaaagtcagatggatataactgatatcaatgctccaaagccaaagaag
aaacagcgatggactcccctggagatcagcctctctgtgcttgtcttgctcctgactatc
atagcggtgacaatgatcgctctctatgcaacctatgatgatggcatttgcaaatcatca
gactgcataaaatcagctgctcgactgattcagaatatggatgcctctgttgagccatgt
acagacttcttcaagtatgcttgtggaggctggttgaaacgcaacgtcattcccgagacc
agttcccgatacagtaattttgacattttaagagatgagctagaagtcattttgaaagat
gtccttcaagaacccaaaactgaagacatagtagcagtgcagaaagcaaaaaccttgtac
agatcgtgtataaatgagtctgctattgatagcagaggcggacaacctctactcaaactg
ttaccagatatatatgggtggccagtagcatcagataactgggatcaaacatatggcact
tcttggacagctgagaaatccattgcacaactgaattctaaatatgggaaaaaggtcctc
attaatttttttgttggcactgatgataagaattctacccagcatataattcattttgac
cagcctcgacttggcctcccttccagagactactatgagtgcactggaatatataaagag
gcttgcacagcatatgtggattttatgatttctgtggccagactgattcgtcaggaacaa
agtttgcctattgatgaaaaccagctctctttggaaatgaataaagttatggaattggaa
aaagaaattgccaatgctacaactaaaccagaagaccgaaatgacccaatgctgctttat
aacaaaatgacattggccaagctgcagaacaacttttccctggaggtcaatgggaagtca
ttcagctggtcaaatttcacaaatgaaatcatgtcaactgtgaatattaatattcaaaat
gaggaagaagttgttgtctatgctccagaatatttaaccaaacttaagcctattcttacc
aaatattctcccagagatcttcaaaatttaatgtcctggaggttcataatggatcttgta
agcagcctcagccgaaactacaaggagtccagaaatgctttccgcaaggccctttatggg
actacatcagaaactgcaacatggagacggtgtgctaactacgtcaatgggaatatggag
aatgctgtggggaggctttatgtggaagcggcttttgctggagagagcaagcacgtggtt
gaagacttgattgcacaaatccgggaagtttttattcagactttggatgaccttacttgg
atggatgctgagacaaaaaagaaagctgaagaaaaggccttggcaattaaagaaaggatt
ggctatcctgatgacatcatttccaatgagaacaaactgaataatgagtatcttgagttg
aactacagggaagatgaatactttgagaacataattcaaaatttgaaattcagccaaagc
aagcagctaaagaagctccgagaaaaagtggacaaagatgagtggataagtggagcagct
gtagtcaatgcattttattcctcaggccgaaatcagatagtcttccccgctggcattttg
cagcccccattcttcagtgctcagcaatccaactcattgaactatgggggcatcggcatg
gtcattggacatgaaatcacacatggatttgatgacaatggaagaaatttcaataaagat
ggagacctcgttgactggtggacgcagcagtcggcaaataattttaaagaccaatcccag
tgtatggtataccagtatggaaacttttcctgggacctagcaggtggacagcatctcaat
ggaattaatacactaggagaaaacattgctgataatggaggtattggccaagcatacaga
gcctatcagaattatgttaaaaagaatggtgaagaaaaattactccctggacttgacctc
aatcacaaacaactatttttcctgaactttgcccaggtgtggtgtgggacctaccggcca
gagtatgcagtcaattctattaaaacagatgtacacagtcctggaaatttcaggatcatt
gggactttgcagaactctgccgagtttgcagatgcctttcattgccgcaagaattcatac
atgaatccagaaaggaaatgtcgggtttggtga

DBGET integrated database retrieval system