KEGG   Mus musculus (house mouse): 17388
Entry
17388             CDS       T01002                                 
Symbol
Mmp15, MT-MMP_2, MT2-MMP
Name
(RefSeq) matrix metallopeptidase 15
  KO
K07995  matrix metalloproteinase-15 (membrane-inserted) [EC:3.4.24.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    17388 (Mmp15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17388 (Mmp15)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     17388 (Mmp15)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   17388 (Mmp15)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Metallopep Reprolysin_3 DUF4953 Peptidase_M66 Peptidase_M54
Other DBs
NCBI-GeneID: 17388
NCBI-ProteinID: NP_032635
MGI: 109320
Ensembl: ENSMUSG00000031790
UniProt: O54732
Position
8:96078924..96100921
AA seq 657 aa
MGSDRSALGRPGCTGSCLSSRASLLPLLLVLLDCLGHGTASKDAEVYAAENWLRLYGYLP
QPSRHMSTMRSAQILASALAEMQSFYGIPVTGVLDEETKTWMKRPRCGVPDQFGVHVKAN
LRRRRKRYTLTGKAWNNYHLTFSIQNYTEKLGWYNSMEAVRRAFQVWEQVTPLVFQEVSY
DDIRLRRRAEADIMVLFASGFHGDSSPFDGVGGFLAHAYFPGPGLGGDTHFDADEPWTFS
STDLHGISLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDTDNFQLPEDDLRGIQQLYG
SPDGKPQPTRPLPTVRPRRPGRPDHQPPRPPQPPHPGGKPERPPKPGPPPQPRATERPDQ
YGPNICDGNFDTVAVLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGNISAAYE
RQDGHFVFFKGNRYWLFREANLEPGYPQPLSSYGTDIPYDRIDTAIWWEPTGHTFFFQAD
RYWRFNEETQHGDPGYPKPISVWQGIPTSPKGAFLSNDAAYTYFYKGTKYWKFNNERLRM
EPGHPKSILRDFMGCQEHVEPRSRWPDVARPPFNPNGGAEPEADGDSKEENAGDKDEGSR
VVVQMEEVVRTVNVVMVLVPLLLLLCILGLAFALVQMQRKGAPRMLLYCKRSLQEWV
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgggcagcgaccggagcgcactcggacgtccaggctgcactggcagctgcctcagcagc
cgagcttcgctgctcccgctgctactggtgcttctggactgtctgggccatggtacagcg
tctaaagacgccgaagtgtacgccgcggagaactggctgcggctctatggctacctaccc
cagcccagccgccacatgtccaccatgcgctctgcccagatcctggcctccgcccttgcc
gagatgcagagtttctatgggatccctgtcacgggtgtgcttgatgaagagacgaaaacg
tggatgaagcggccccgatgtggggttcctgatcagtttggggtacatgtgaaagccaac
ctgcgtcgacggcggaaacgttacaccctgacaggaaaggcatggaacaattaccacctg
accttcagcatccagaactacactgagaagctgggctggtacaactccatggaggcggtg
cgcagggctttccaagtgtgggagcaggtcacaccattggtcttccaggaagtatcctat
gatgacattcggctacgaaggcgagcggaggctgacatcatggtactctttgcctctggc
ttccatggcgacagctcaccgtttgatggcgtgggtggctttctggcccacgcttatttc
cccggccctggtctgggtggggacacccatttcgacgcagatgaaccctggaccttctcc
agcactgacctgcatggaatcagcctctttctggtggccgtgcatgagctgggccatgcc
ctggggctagaacactcaagtaaccccagcgctattatggcacccttctaccagtggatg
gataccgacaacttccagctgcccgaagatgaccttcggggcatccagcagctgtatggc
tccccagatggtaagccacagcccacccggcctctccccactgtgaggccccggcggcca
ggacggccagatcaccagccacctcggcctccccagccaccacatccaggtgggaagcca
gaaaggccccccaaaccagggcccccaccccagccccgagccacagagaggcctgaccag
tatggccccaacatctgcgatggcaacttcgacacagtggctgtgctccgcggagagatg
tttgtgttcaagggccgctggttctggcgagtcaggcacaaccgcgttctagacaactac
cccatgccaattggccacttctggcgcggtctgccggggaacatcagtgctgcctacgag
cgccaggatggacattttgtcttcttcaaaggtaaccgctactggcttttccgagaagcc
aatctggagcccggctacccacagccgctgagcagctatggcacagacatcccctatgac
cgcattgacacagccatctggtgggagcccacaggtcacaccttcttctttcaagcagac
aggtactggcgcttcaacgaggagacacagcatggagaccctggctaccccaagcccatc
agtgtctggcaggggatccccacctctcccaaaggggccttcctcagcaacgatgcagcc
tacacctacttctacaagggcaccaagtactggaaattcaacaacgaacgcctacggatg
gaacccggccaccccaaatccatcctgcgggacttcatgggctgccaggagcacgtggag
ccccgatcgcgatggcccgatgtggctcgtccacccttcaaccccaacgggggtgccgag
cctgaggcagatggtgacagcaaggaagagaacgcgggtgacaaggatgagggcagccgc
gtggtggtgcagatggaggaggtggtccggacagtgaacgtggtgatggtgttggtcccc
ttgctgctgttgctctgtattctgggcctggcctttgctctggtgcagatgcagcgcaag
ggcgcccctcgcatgctgctctactgcaagcgctcactgcaggagtgggtgtga

DBGET integrated database retrieval system