KEGG   Mus musculus (mouse): 17390
Entry
17390             CDS       T01002                                 

Gene name
Mmp2, Clg4a, GelA, MMP-2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04670  Leukocyte transendothelial migration
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05219  Bladder cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17390 (Mmp2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    17390 (Mmp2)
   04915 Estrogen signaling pathway
    17390 (Mmp2)
   04926 Relaxin signaling pathway
    17390 (Mmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17390 (Mmp2)
   05205 Proteoglycans in cancer
    17390 (Mmp2)
  09162 Cancer: specific types
   05219 Bladder cancer
    17390 (Mmp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17390 (Mmp2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    17390 (Mmp2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    17390 (Mmp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17390 (Mmp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     17390 (Mmp2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M10
   17390 (Mmp2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_5 Reprolysin_3 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 17390
NCBI-ProteinID: NP_032636
MGI: 97009
Ensembl: ENSMUSG00000031740
Vega: OTTMUSG00000061536
UniProt: P33434 Q3UG07
Position
8 C5; 8 44.99 cM
AA seq 662 aa
MEARVAWGALAGPLRVLCVLCCLLGRAIAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggaggcacgagtggcctggggagcgctggccggacctctgcgggttctctgcgtcctg
tgctgcctgttgggccgcgccatcgctgcaccatcgcccatcatcaagttccccggcgat
gtcgcccctaaaacagacaaagagttggcagtgcaatacctgaacactttctatggctgc
cccaaggagagttgcaacctctttgtgctgaaagataccctcaagaagatgcagaagttc
tttgggctgccccagacaggtgaccttgaccagaacaccatcgagaccatgcggaagcca
agatgtggcaacccagatgtggccaactacaacttcttcccccgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggttacacacctgacctggaccctgaaaccgtg
gatgatgcttttgctcgggccttaaaagtatggagcgacgtcactccgctgcgcttttct
cgaatccatgatggggaggctgacatcatgatcaactttggacgctgggagcatggagat
ggatacccatttgatggcaaggatggactcctggcacatgcctttgccccgggcactggt
gttgggggagattctcactttgatgatgatgagctgtggaccctgggagaaggacaagtg
gtccgcgtaaagtatgggaacgctgatggcgagtactgcaagttccccttcctgttcaac
ggtcgggaatacagcagctgtacagacactggtcgcagtgatggcttcctctggtgctcc
accacatacaactttgagaaggatggcaagtatggcttctgcccccatgaagccttgttt
accatgggtggcaatgcagatggacagccctgcaagttcccgttccgcttccagggcacc
tcctacaacagctgtaccaccgagggccgcaccgatggctaccgctggtgtggcaccacc
gaggactatgaccgggataagaagtatggattctgtcccgagaccgctatgtccactgtg
ggtggaaattcagaaggtgccccatgtgtcttccccttcactttcctgggcaacaagtat
gagagctgcaccagcgccggccgcaacgatggcaaggtgtggtgtgcgaccacaaccaac
tacgatgatgaccggaagtggggcttctgtcctgaccaaggatatagcctattcctcgtg
gcagcccatgagttcggccatgccatggggctggaacactctcaggaccctggagctctg
atggccccgatctacacctacaccaagaacttccgattatcccatgatgacatcaagggg
atccaggagctctatgggccctcccccgatgctgatactgacactggtactggccccaca
ccaacactgggacctgtcactccggagatctgcaaacaggacattgtctttgatggcatc
gctcagatccgtggtgagatcttcttcttcaaggaccggtttatttggcggacagtgaca
ccacgtgacaagcccacaggtcccttgctggtggccacattctggcctgagctcccagaa
aagattgacgctgtgtatgaggccccacaggaggagaaggctgtgttcttcgcagggaat
gagtactgggtctattctgctagtactctggagcgaggataccccaagccactgaccagc
ctggggttgccccctgatgtccagcaagtagatgctgcctttaactggagtaagaacaag
aagacatacatctttgcaggagacaagttctggagatacaatgaagtgaagaagaaaatg
gaccccggtttccctaagctcatcgcagactcctggaatgccatccctgataacctggat
gccgtcgtggacctgcagggtggtggtcatagctacttcttcaagggtgcttattacctg
aagctggagaaccaaagtctcaagagcgtgaagtttggaagcatcaaatcagactggctg
ggctgctga

DBGET integrated database retrieval system