KEGG   Mus musculus (mouse): 17433Help
Entry
17433             CDS       T01002                                 

Gene name
Mobp, AI835053, AI839848, MOBP155, MOBP170, MOBP69, MOBP73, MOBP81, R74645
Definition
(RefSeq) myelin-associated oligodendrocytic basic protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE_2 DUF3725
Motif
Other DBs
NCBI-GeneID: 17433
NCBI-ProteinID: NP_001034454
MGI: 108511
Ensembl: ENSMUSG00000032517
Vega: OTTMUSG00000037099
UniProt: Q9D2P8
Position
9 F4; 9 71.41 cM
AA seq 170 aa AA seqDB search
MSQKMAKEGPRLSKNQKFSEHFSIHCCPPFTFLNSKREIVDRKYSICKSGCFYQKKEEDW
ICCACQKTSRRATSPQRPKHQPAASPVVVRAPPAKPKSPLMPAKPRSPPRPAKPRSPSRT
ERQPRPRPEVRPPPAKQKPPQKSKQPARSSPLRGPGTSRGGSPTRAPRFW
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaaaatggccaaggagggccccaggctctccaagaaccagaagttctccgag
cacttcagcatccactgctgcccacccttcaccttcctcaactccaagcgtgagatcgtg
gaccgcaagtacagcatctgcaagagcggttgcttttaccagaagaaggaggaggactgg
atctgctgtgcctgccagaagactagccgccgtgccacgtcccctcagaggcccaagcac
cagccagctgcgtccccagtggtggtcagagcgccgccagccaagccaaagtcccctctg
atgccagccaagccaaggtccccaccgaggccagccaagccaaggtccccttcaaggact
gagcgccagccgcgtccccgcccagaggtccgaccaccaccagccaagcagaagccccct
cagaagtctaagcagccagcacgcagcagccccctcagagggccaggcaccagccgcggg
gggtctcccaccagagctcctaggttctggtaa

DBGET integrated database retrieval system