KEGG   Mus musculus (mouse): 17436Help
Entry
17436             CDS       T01002                                 

Gene name
Me1, D9Ertd267e, Mdh-1, Mod-1, Mod1
Definition
(RefSeq) malic enzyme 1, NADP(+)-dependent, cytosolic
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    17436 (Me1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    17436 (Me1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     17436 (Me1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic Trimer_CC
Motif
Other DBs
NCBI-GeneID: 17436
NCBI-ProteinID: NP_032641
MGI: 97043
Ensembl: ENSMUSG00000032418
Vega: OTTMUSG00000045046
UniProt: P06801
Position
9 E3.1; 9 46.58 cM
AA seq 572 aa AA seqDB search
MEPRAPRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIK
NFERLNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKP
RGLFISIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
GGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNC
LIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTVLFQ
GAGEAALGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEE
MKNLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLT
TAEVISQQVSDKHLQEGRLYPPLNTIRGVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFV
SSQMYSTNYDQILPDCYPWPAEVQKIQTKVNQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggagccccgagccccccgccgccgacacacccaccagcgcggctacctgctgacgcgg
gacccgcatctcaacaaggacttggcttttactctggaagagagacagcagttgaacatt
catggattgttgccgccctgcatcatcagccaggagctccaggtccttagaataattaag
aatttcgaacgactgaactctgacttcgacaggtatctcctgttaatggacctgcaagac
agaaatgagaagctcttctacagcgtgctcatgtctgatgttgaaaagttcatgcctatt
gtttacacccccaccgtgggcctcgcatgccagcagtacagtttggcattccggaagcca
agaggcctctttattagtatccatgacaaagggcacattgcttcagttcttaatgcatgg
ccagaggatgtcgtcaaggctattgtggtaactgatggagagcgcatccttggcttggga
gaccttggctgtaatgggatgggcatccctgtgggtaaactggccctgtacacggcatgt
ggaggggtgaacccacaacagtgtctacccatcactttggatgtgggaacagaaaatgag
gagttacttaaggatccactgtacatcgggctgcggcaccggcgagtcagaggccctgag
tatgacgccttcctggatgagttcatggaggcagcgtcttccaaatatggcatgaattgc
cttattcagtttgaagattttgccaatcggaatgcatttcgtctcctgaacaagtatcga
aacaagtattgcacatttaacgatgatattcaaggaacagcgtctgttgcggttgcgggt
ctccttgcagctcttcgaataaccaagaacaagctctctgatcagacagtgctgttccag
ggagctggagaggctgccttggggattgctcacttggttgttatggccatggagaaagaa
ggtttatcaaaggagaatgctagaaagaagatatggttggttgactcaaaaggactaata
gttaagggtcgtgcatctctcacagaagagaaagaggtgtttgcccatgaacatgaagaa
atgaagaatctggaagccattgttcaaaagataaaaccaactgccctcataggagttgct
gcaattggtggtgctttcactgaacaaattctcaaggatatggctgccttcaacgagcgg
cccatcatctttgctttgagtaatccgaccagcaaagcggagtgctctgcagagcagtgc
tacaaggtgaccaagggacgtgcaatctttgccagcggcagtccttttgatccagtcact
ctcccagatggacggactctgtttcctggccaaggcaacaattcctacgtgttccctgga
gttgctcttggggtggtggcctgcggactgagacacatcgatgataaggtcttcctcacc
actgctgaggtcatatctcagcaagtgtcagataaacacctgcaagaaggccggctctat
cctcctttgaataccattcgaggcgtttcgttgaaaattgcagtaaagattgtgcaagat
gcatacaaagaaaagatggccactgtttatcctgaaccccaaaacaaagaagaatttgtc
tcctcccagatgtacagcactaattatgaccagatcctacctgattgttatccgtggcct
gcagaagtccagaaaatacagaccaaagtcaaccagtaa

DBGET integrated database retrieval system