KEGG   Mus musculus (mouse): 17448Help
Entry
17448             CDS       T01002                                 

Gene name
Mdh2, MDH, Mdh-2, Mor-1, Mor1
Definition
(RefSeq) malate dehydrogenase 2, NAD (mitochondrial)
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    17448 (Mdh2)
   00620 Pyruvate metabolism
    17448 (Mdh2)
   00630 Glyoxylate and dicarboxylate metabolism
    17448 (Mdh2)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17448 (Mdh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     17448 (Mdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Semialdhyde_dh THF_DHG_CYH_C 3Beta_HSD NAD_binding_10 DapB_N
Motif
Other DBs
NCBI-GeneID: 17448
NCBI-ProteinID: NP_032643
MGI: 97050
Ensembl: ENSMUSG00000019179
Vega: OTTMUSG00000022781
UniProt: P08249
Position
5 G2; 5 75.4 cM
AA seq 338 aa AA seqDB search
MLSALARPAGAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
TPGVAADLSHIETRANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
VATLTAACAQHCPEAMVCIIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGRIQEAGTEVVKA
KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVQSKETECTYFSTPLLLGKKGLE
KNLGIGKITPFEEKMIAEAIPELKASIKKGEDFVKNMK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgctctcgcccgtcctgccggcgccgctctccgccgcagcttcagcacttcg
gcccagaacaatgctaaagtggctgtcctgggagcttctgggggcattgggcaacccctt
tcactcctgctgaagaacagccccctagtgagccgcctgaccctctacgatatcgctcac
acacctggtgtggcagcagatctgagtcacattgagaccagagcaaatgtgaaaggctac
cttggaccggagcagttgccagattgcctcaaaggttgtgatgtggtggtcatcccagcc
ggagtgcccaggaaaccaggaatgacacgggatgacctgttcaacaccaacgctaccatt
gtggccaccctgacggctgcctgtgcccagcactgtcctgaagccatggtttgcatcatt
gccaacccagtgaactccaccatccccatcacagcagaagttttcaagaagcacggtgtg
tacaaccctaacaagatcttcggtgtgacaacccttgacatcgtcagagcgaacacgttt
gtggcagagctaaagggtttggatccagctcgagtcaacgtgcctgtcattggcggccac
gccgggaagacgatcatccccctgatctctcagtgtaccccgaaggttgactttccccaa
gaccagctggccacactcaccgggaggatccaggaggctggcacagaagtcgtgaaggcc
aaggctggagcaggttctgccactctgtccatggcttatgctggagcccgctttgtcttc
tccctcgtggacgccatgaacgggaaggaaggagtcgttgagtgttcttttgttcagtcc
aaagagacggaatgcacttacttctctacgcccttgctcttggggaaaaagggcctggag
aagaacctgggcattggcaagatcactccttttgaggaaaaaatgattgccgaggctatc
cctgagctgaaagcctccatcaagaaaggcgaggactttgtcaagaacatgaagtga

DBGET integrated database retrieval system