KEGG   Mus musculus (mouse): 17449
Entry
17449             CDS       T01002                                 

Gene name
Mdh1, B230377B03Rik, D17921, MDH-, MDH-s, MDHA, Mo, Mor, Mor-2, Mor2
Definition
(RefSeq) malate dehydrogenase 1, NAD (soluble)
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00270  Cysteine and methionine metabolism
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04964  Proximal tubule bicarbonate reclamation
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    17449 (Mdh1)
   00620 Pyruvate metabolism
    17449 (Mdh1)
   00630 Glyoxylate and dicarboxylate metabolism
    17449 (Mdh1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    17449 (Mdh1)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    17449 (Mdh1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     17449 (Mdh1)
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4809 Glyco_hydro_3_C
Other DBs
NCBI-GeneID: 17449
NCBI-ProteinID: NP_032644
MGI: 97051
Ensembl: ENSMUSG00000020321
Vega: OTTMUSG00000005249
UniProt: P14152
Position
11 A3.1; 11 13.89 cM
AA seq 334 aa
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKL
SSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKETAFEFLSSA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctgaaccaatcagagtccttgtgactggagcagctggtcaaattgcatattcactg
ttgtacagtattggaaatggatctgtctttgggaaagaccagcccatcattcttgtgctg
ttggacatcacccccatgatgggtgttctggacggtgtcctgatggaactgcaagactgt
gcccttccccttctgcaggatgtcattgcaacggacaaagaagagattgccttcaaagac
ctggatgtggctgtcctagtgggctccatgccaagaagggaaggcatggagaggaaggac
ctactgaaagccaatgtgaaaatcttcaaatcccagggcacagccttggagaaatacgcc
aagaaatcagttaaggtcattgttgtgggaaacccagccaatacgaactgcctgacagcc
tccaagtcagcgccatcgatccccaaggagaatttcagttgcctgactcgcttggaccac
aaccgagcaaaatctcaaattgctcttaaactcggtgtaaccgctgatgatgtaaagaat
gtcattatctggggaaatcattcatcgacccagtatccagatgtcaatcatgccaaggtg
aaactgcaaggaaaggaagtcggtgtgtatgaagccctgaaagacgacagctggctgaag
ggagagttcatcacgactgtgcaacagcgtggtgctgctgtcatcaaggctcggaagctg
tccagtgcaatgtctgctgcgaaagccatcgcagaccacatcagagacatctggtttgga
accccagagggagagttcgtgtcgatgggtgttatctctgatggcaactcctatggtgtc
cctgatgacctgctctactcattccctgtcgtgatcaagaataagacctggaagtttgtt
gaaggcctccccattaatgacttctcccgtgaaaagatggacctgacagcaaaggagctg
accgaggaaaaggagaccgcttttgagtttctctcctctgcgtga

DBGET integrated database retrieval system