KEGG   Mus musculus (mouse): 17451
Entry
17451             CDS       T01002                                 

Gene name
Mos, c-m, c-mos
Definition
(RefSeq) Moloney sarcoma oncogene
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04810  Regulation of actin cytoskeleton
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    17451 (Mos)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17451 (Mos)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    17451 (Mos)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17451 (Mos)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     17451 (Mos)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  MOS family
   17451 (Mos)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 TCAD9
Other DBs
NCBI-GeneID: 17451
NCBI-ProteinID: NP_064405
MGI: 97052
Ensembl: ENSMUSG00000078365
Vega: OTTMUSG00000004409
UniProt: P00536
Position
4 A1; 4 2.16 cM
AA seq 343 aa
MPSPLSLCRYLPRELSPSVDSRSCSIPLVAPRKAGKLFLGTTPPRAPGLPRRLAWFSIDW
EQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAELNIARLRHDNI
VRVVAASTRTPEDSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSL
DVVNGLLFLHSQSILHLDLKPANILISEQDVCKISDFGCSQKLQDLRCRQASPHHIGGTY
THQAPEILKGEIATPKADIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAV
FTASLTGKTLQNIIQSCWEARALQRPGAELLQRDLKAFRGALG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgccttcgcctctaagcctgtgtcgctacctccctcgtgagctgtcgccatcggtggac
tcgcggtcctgcagcattcctttggtggccccgaggaaggcagggaagctcttcctgggg
accactcctcctcgggctcccggactgccacgccggctggcctggttctccatagactgg
gaacaggtatgtctgatgcataggctgggctctggagggtttggctcggtgtataaagcc
acttaccacggtgttcctgtggccatcaagcaagtaaacaagtgcaccaaggacctacgt
gcatcccagcggagtttctgggctgaactgaacattgcaagactacgccacgacaacata
gttcgggttgtggctgccagcacgcgcacgcccgaagactccaacagcctaggtaccata
atcatggagtttgggggcaacgtgactctacaccaagtcatctacggtgccacccgctca
ccggagcctctcagctgcagagaacaactgagtttggggaagtgcctcaagtattcccta
gatgttgttaacggcctgctttttctccactcacaaagcattttgcacttggacctgaag
ccagcgaacattttgatcagtgagcaagacgtttgtaagatcagtgacttcggctgctcc
cagaagctgcaggatctgcggtgccggcaggcgtcccctcaccacatagggggcacgtac
acgcaccaagctccggagatcctgaaaggagagattgccacgcccaaagctgacatctac
tcttttggaatcaccctgtggcagatgaccaccagggaggtgccttactccggcgaacct
cagtacgtgcagtatgcagtggttgcctacaatctgcgcccctcactggcaggggcggtg
ttcaccgcctccctgactggaaagacactgcagaacatcatccagagctgctgggaggcc
cgcgccctgcagaggccgggtgcagaactgctccaaagggacctcaaggctttccgaggg
gcactaggctga

DBGET integrated database retrieval system