KEGG   Mus musculus (mouse): 17454
Entry
17454             CDS       T01002                                 

Symbol
Mov10, C77703, Mov-10
Name
(RefSeq) Mov10 RISC complex RNA helicase
  KO
K18422  helicase MOV-10 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    17454 (Mov10)
   03036 Chromosome and associated proteins [BR:mmu03036]
    17454 (Mov10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     17454 (Mov10)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     17454 (Mov10)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     17454 (Mov10)
SSDB
Motif
Pfam: AAA_12 AAA_11 AAA_30 AAA_19 ResIII AAA_22 Helicase_RecD AAA_16 ATPase_2 T2SSE AAA UvrD-helicase
Other DBs
NCBI-GeneID: 17454
NCBI-ProteinID: NP_001156913
MGI: 97054
Ensembl: ENSMUSG00000002227
Vega: OTTMUSG00000022217
UniProt: P23249 Q3UD86
Position
3:complement(104702144..104725935)
AA seq 1004 aa
MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPSYGTPAPGFSSMLYG
MKIANLAFVTKTRVRFFKLDRWADVQLPEKRRIKPGSNISKQHRSLLARIFHDRAEYLHG
KHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLFPLCWTPQFVFY
HGEQDLPCPLGPGESYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAA
VAHSPLAAQLKPTTPFKRPPRLTRNSVLTNRIEEGERPDRAKGYELELSLALGTYYPPIL
LRQLLPTLLQGPSIFTAPKEVAEIKAQLETTLKSRNYEVKLRLLLHLEELQMEHDIRHYD
LDSVPMTWDPVDQNPRLLTLEVPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHK
VELDRVKLSFSTSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWVLWPMLFPVASR
GVSLLPSDVKFKLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIK
QVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKTCCNWD
AKKGEYVYPAKKHLQQYRVLITTLITASRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAI
AGLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNG
YDPQFITKLLRNYRSHPTILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQGFPIIFH
GVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQVEK
IRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFL
KNPKRFNVAVTRAKALLIVVGNPLLLGHDPDWKTFLEFCKENGGYTGCPFPAKLDLQQGQ
DLLQGLSKLSPSTSGPRRHQNLPQEREGEGGLPLQVEPEWRNEL
NT seq 3015 nt   +upstreamnt  +downstreamnt
atgcctagcaagttcagctgccgaaagctccgggagaccggccagaggttcgagagtttt
ctggccgaacgtggactggacctggagacagatcgtgagcggctgcggacgatttacaac
cacgacttcaagcccagctatgggacccctgcccctggcttctcctccatgctgtatgga
atgaagatcgcaaatctggccttcgtcaccaagactcgggtcaggttcttcaaactagac
cgctgggctgatgtgcagttaccagaaaagaggcgaataaagccagggtcgaacatcagc
aaacaacacagatcactgttggccaggatctttcacgacagggctgagtaccttcatggg
aagcatggggtagacgtggaggtccaggggccccatgaagcccgagacgggcaactcctt
atccacctggatttgaaccgcaaggaggtactaaccctacggcttcggaacggcggaagc
aaacctgtcaccctcactcacctattcccactgtgctggacgccccagtttgtcttctac
catggagaacaggacctgccctgcccactgggccccggtgaaagctatgaactccacatc
tactgtaagaccagcattgtgggttacttcccagccactgtcctctgggaactcctggga
cccggggagtcgggagcagaaggagcagaaactttctacattgcccgattcctggcggct
gtcgcccacagtcccctggctgcccagttgaaacccacaactcccttcaaacgcccccct
cggctcaccagaaactctgtgttgaccaaccggatcgaggaaggagagaggcccgaccga
gccaagggctatgaactagagctaagtttggccctggggacctattacccacccatcctc
ctccgacaactgctccctacccttcttcagggaccaagtatcttcactgccccaaaggag
gttgctgagatcaaggcccagctggagacaaccctgaaatccaggaactatgaggtgaaa
ctccggctgctgctgcacctggaagagctgcagatggagcatgacatccggcactatgac
ctggactcggtacccatgacctgggaccctgtggaccagaatcccaggctgctcaccctg
gaggttcctggtgtcgcagagagccgtccctcagtgctacgaggtgaccacctttttgcc
cttttgtcctctgagacccaacaggacgaccctgtcacctacaagggtttcgtgcacaag
gtggaactggaccgtgtcaagctgagcttttctacaagcctcctgagccgatttgtggat
gggctgaccttcaaggtgaactttaccttcaaccgccagccccttcgggtccagcaccgg
gccctagagttgacggggcgctgggtgctatggcccatgctttttcctgtggcctcccgt
ggggtctcgttgctgccctcagatgtgaagttcaagctgtacgatcggagtctggagtca
aaccctgagcaactgcaggccatgaagcacattgtgaggggtaccacccggcctgccccc
tacatcatctttgggcctccaggtaccggcaagactgtcacattagtggaggccatcaaa
caggtagtgaagcatttgcccaaagcccacatcctggcctgtgctccatccaactcaggg
gctgacctcctctgtcagcggctccgggtccacctgcccagctccatctaccgtctcctg
gcccccagcagggacatccgaatggtgcctgaggacattaagacctgctgtaactgggat
gctaagaagggagaatatgtgtatcctgctaagaagcacctgcagcaatatcgggtctta
attaccaccctcatcactgccagcaggttggtgtcagcccagtttcccatcgatcacttc
acacacatcttcatcgatgaggctggccactgcatggagcctgagagtctggtggccata
gcaggactgatggatgtcaaggaaacgggcaatcccggagggcagctggtactggcagga
gaccctcggcagctggggcctgtgctgcgctcgccactagccctgaagcatggacttggc
tactctctgctagagcgcctgctcgcctacaactccttgtataagaagggccccaatggc
tatgacccccagttcatcaccaaactgctccgcaactacaggtctcaccccaccatcctg
gacatccctaaccagctgtactacgacggagagctgcaggcctgcgcagatgtggtggat
cgagaacggttctgccgctgggaggggctgcctcagcagggcttccccatcattttccat
ggtgtaatgggcaaagatgagagagaaggcaatagcccatccttcttcaaccctgaagag
gctgctacagtgacgtcatacctgaaacaactcctggccccttcctccaagaagggtaaa
gcccgcctgagcccccgaaatgtgggcgtcatctccccgtaccggaagcaggtagaaaaa
atccgttactgcatcacaaaacttgaccgagaacttcgcggactggatgacatcaaagat
ttgaaggtgggctctgtggaagagttccaaggccaagaacgcagcgtcatcctcatctcc
accgtccgaagcagccagagctttgtacagctggatctagactttaacctcggtttcctt
aagaaccccaagaggttcaatgttgctgtgacccgagccaaggctttgctcatcgtagtg
ggcaaccccctcctcctaggccacgacccagactggaaaacgttcctggagttctgtaaa
gaaaacgggggatataccgggtgcccctttcctgccaaactggacctgcagcagggacag
gacttgctccaaggtctgagcaaactcagcccctctacctcagggccccgccgtcaccag
aatctcccccaggagcgggagggtgaagggggcctgcccttacaagtggagccagagtgg
agaaatgagctctga

DBGET integrated database retrieval system