KEGG   Mus musculus (mouse): 17463
Entry
17463             CDS       T01002                                 

Gene name
Psmd7, AW107203, Mov, Mov-, Mov-34, Mov34
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    17463 (Psmd7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    17463 (Psmd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17463 (Psmd7)
   05012 Parkinson disease
    17463 (Psmd7)
   05014 Amyotrophic lateral sclerosis
    17463 (Psmd7)
   05016 Huntington disease
    17463 (Psmd7)
   05017 Spinocerebellar ataxia
    17463 (Psmd7)
   05020 Prion disease
    17463 (Psmd7)
   05022 Pathways of neurodegeneration - multiple diseases
    17463 (Psmd7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    17463 (Psmd7)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     17463 (Psmd7)
SSDB
Motif
Pfam: MitMem_reg JAB Coilin_N Connexin
Other DBs
NCBI-GeneID: 17463
NCBI-ProteinID: NP_034947
MGI: 1351511
Ensembl: ENSMUSG00000039067
Vega: OTTMUSG00000061936
UniProt: P26516 A1L3B8
Position
8 D3; 8 54.38 cM
AA seq 321 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDA
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKEKSDAAKKEEKKEKK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtggttcaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaattggcaaggttggaaaccagaagcgggtagttggtgtgcttttg
ggatcatggcaaaagaaagtacttgatgtatccaacagttttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatggg
atgttcaagaaggtcaatgccagagaaaggatagttgggtggtaccacacaggccccaaa
ctgcacaagaatgatatcgccatcaatgaactcatgaagagatactgccccaactcagta
ttggtcattatcgacgtgaagccaaaggacctaggacttcccaccgaagcctacatctca
gtggaggaagttcatgacgatgggacgccaacgtcaaaaacttttgagcatgtgactagc
gagattggagcagaggaggcggaggaagtcggagtggagcacttactaagagacatcaag
gacactacagtggggactctctcccagcggatcacaaaccaggtccatggcttgaaggga
ctgaactccaagctcctggatatcaggagctacctggagaaggtagccagcggcaagctg
cccatcaaccaccagatcatataccagctgcaggacgtcttcaacctgctgccggacgcc
agcctgcaggagtttgtcaaggccttctacctgaagaccaatgaccagatggtggtggtg
tacctggcctcgctgatccgctctgtggtcgccttgcataacctcatcaacaacaagatt
gccaaccgggatgccgagaagaaggagggacaggaaaaggaggagagcaagaaggagaga
aaagacgacaaagagaaggagaagagcgacgcagcgaagaaagaagagaaaaaggagaaa
aagtaa

KEGG   Mus musculus (mouse): 19179
Entry
19179             CDS       T01002                                 

Gene name
Psmc1, AI325227, P26, P26s4, Rpt2/S4, S, S4, rp, rpt2
Definition
(RefSeq) protease (prosome, macropain) 26S subunit, ATPase 1
  KO
K03062  26S proteasome regulatory subunit T2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19179 (Psmc1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    19179 (Psmc1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19179 (Psmc1)
   05165 Human papillomavirus infection
    19179 (Psmc1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19179 (Psmc1)
   05012 Parkinson disease
    19179 (Psmc1)
   05014 Amyotrophic lateral sclerosis
    19179 (Psmc1)
   05016 Huntington disease
    19179 (Psmc1)
   05017 Spinocerebellar ataxia
    19179 (Psmc1)
   05020 Prion disease
    19179 (Psmc1)
   05022 Pathways of neurodegeneration - multiple diseases
    19179 (Psmc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19179 (Psmc1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     19179 (Psmc1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 IstB_IS21 AAA_25 ATPase AAA_28 AAA_33 AAA_3 RNA_helicase AAA_14 TIP49 Mg_chelatase PhoH AAA_7 Prot_ATP_OB_N NACHT AAA_24 NB-ARC AAA_30 ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 19179
NCBI-ProteinID: NP_032973
MGI: 106054
Ensembl: ENSMUSG00000021178
UniProt: P62192 Q542I9
Position
12 E; 12 50.43 cM
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagccagagtggtggccatggtcctgggggtggcaagaaggatgacaaggac
aagaaaaagaaatacgaacctcctgtcccaactagagtggggaaaaagaagaagaaaaca
aagggaccagatgctgccagcaaactgccactggtaacacctcacacccagtgccgcctg
aaattactgaagctagagagaataaaagactatcttctcatggaggaggaattcattaga
aaccaggaacagatgaaaccattagaagaaaagcaagaggaggaaagatcaaaagtggat
gatctcagggggacccccatgtctgtaggaaccttggaagagatcattgatgataatcac
gccattgtgtccacatctgtgggctcagaacactacgtcagcatcctgtcgtttgtagac
aaggatctgctggaaccaggctgctccgtcctgctcaaccacaaggtgcatgctgtgata
ggggtgctaatggatgacacggatcccctggtcacagtgatgaaggtggaaaaggccccc
caggagacctacgcagatattgggggactggacaaccagatccaagaaattaaggagtct
gtggagctcccgcttacccatcctgagtattacgaggagatggggataaagccccctaag
ggggtcattctctacggtccgccaggaacaggtaaaactctattggccaaagcagtagcg
aaccagacttcagccactttcttgcgagtggttggctcagagcttatccagaagtaccta
ggtgacgggcccaaacttgtccgggagctcttccgggtcgctgaggagcatgcgccgtcc
atcgtgttcattgatgagatcgacgccattgggaccaaaagatatgattcaaattctgga
ggtgagagagaaattcagcgaacaatgttggaactgttgaaccagttggatggatttgat
tcgaggggagatgtaaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcaggccaggccgcattgacagaaagatcgagttccccctgccggatgagaagacc
aagaagcgtatcttccagattcacaccagcaggatgacactggctgatgatgtaaccttg
gatgacttgatcatggcaaaggatgacctctctggggccgacatcaaggcaatctgtaca
gaagctggcttgatggccttgcgggaacgcagaatgaaagtaacaaatgaagacttcaaa
aaatctaaagagaatgttctttataaaaaacaagaaggcacccctgaggggctctatctc
tag

KEGG   Mus musculus (mouse): 19181
Entry
19181             CDS       T01002                                 

Gene name
Psmc2
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, ATPase 2
  KO
K03061  26S proteasome regulatory subunit T1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19181 (Psmc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19181 (Psmc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19181 (Psmc2)
   05012 Parkinson disease
    19181 (Psmc2)
   05014 Amyotrophic lateral sclerosis
    19181 (Psmc2)
   05016 Huntington disease
    19181 (Psmc2)
   05017 Spinocerebellar ataxia
    19181 (Psmc2)
   05020 Prion disease
    19181 (Psmc2)
   05022 Pathways of neurodegeneration - multiple diseases
    19181 (Psmc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19181 (Psmc2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     19181 (Psmc2)
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 AAA_2 DUF815 RuvB_N AAA_18 AAA_7 AAA_28 AAA_33 Sigma54_activ_2 Mg_chelatase AAA_14 TIP49 IstB_IS21 AAA_24 Prot_ATP_ID_OB RNA_helicase HMW1C_N T2SSE AAA_3 Sigma54_activat
Other DBs
NCBI-GeneID: 19181
NCBI-ProteinID: NP_035318
MGI: 109555
Ensembl: ENSMUSG00000028932
Vega: OTTMUSG00000024688
UniProt: P46471 Q8BVQ9
Position
5 A3; 5 9.97 cM
AA seq 433 aa
MPDYLGADQRKTKEEEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccggattacctaggtgcggaccagcggaaaaccaaagaggaggagaaggacgacaag
cccatccgagctctggatgaaggggatattgccttgctgaaaacttacggccaaagtact
tattcaaggcagatcaagcaggttgaagatgacattcaacaacttctcaaaaaaattaat
gagctcactggtattaaagagtctgacactgggttggcacctccggccctctgggatttg
gctgcagacaaacaaacacttcagagtgaacagccattacaggtggcaagatgtacgaag
ataatcaacgctgattcggaggacccaaaatacatcatcaatgtgaagcagtttgccaag
ttcgtggtggatctcagtgatcaggtggcacccactgacattgaagaagggatgagagtc
ggtgtggacagaaataaataccaaattcacattccactacctcctaagatcgacccaaca
gttaccatgatgcaggtggaggaaaaacccgacgtcacatacagtgatgttggtggctgt
aaggaacagattgagaaattgcgagaagtagttgaaacccctctgctccatccagagagg
tttgttaaccttggaatcgagcctccaaagggtgtactgctgtttgggccaccaggcaca
ggcaagacactctgtgctagggcagttgccaatcggactgatgcttgcttcattcgagtt
attgggtctgagctcgtacagaaatacgtcggcgagggagctcgaatggttcgtgagctt
tttgaaatggccaggacaaaaaaagcctgccttattttctttgatgaaattgatgccatt
ggaggggctcggtttgacgatggcgctgggggtgacaatgaagtgcagagaaccatgctg
gagctcatcaatcagctggatggctttgatcctcgcggcaacatcaaggtgctcatggcc
actaaccgccctgacactctggacccagcgctcatgagaccggggaggctggacaggaag
attgagttcagcttacctgacttagagggtcgaacgcacatctttaagattcacgctcgc
tcaatgagtgtggaaagagacattcgatttgagctgttggcccgcctgtgtccaaacagt
actggagcggagattagaagtgtttgcacagaagctggtatgtttgcaatccgagcacgg
agaaaaattgctacagagaaggacttcttagaagctgtaaataaggtcatcaagtcttac
gccaaattcagcgctactccccgctacatgacatacaattga

KEGG   Mus musculus (mouse): 19182
Entry
19182             CDS       T01002                                 

Gene name
Psmc3, TBP-, TBP-1
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, ATPase 3
  KO
K03065  26S proteasome regulatory subunit T5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19182 (Psmc3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19182 (Psmc3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19182 (Psmc3)
   05012 Parkinson disease
    19182 (Psmc3)
   05014 Amyotrophic lateral sclerosis
    19182 (Psmc3)
   05016 Huntington disease
    19182 (Psmc3)
   05017 Spinocerebellar ataxia
    19182 (Psmc3)
   05020 Prion disease
    19182 (Psmc3)
   05022 Pathways of neurodegeneration - multiple diseases
    19182 (Psmc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19182 (Psmc3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     19182 (Psmc3)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 DUF815 Mg_chelatase PhoH AAA_11 IstB_IS21 Sigma54_activat DUF5827 ATPase AAA_24 DUF3713 AAA_7 RNA_helicase
Other DBs
NCBI-GeneID: 19182
NCBI-ProteinID: NP_032974
MGI: 1098754
Ensembl: ENSMUSG00000002102
Vega: OTTMUSG00000014341
UniProt: O88685 Q3TKG4
Position
2 E1; 2 50.44 cM
AA seq 442 aa
MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKS
EVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQR
KGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEV
DERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLA
RACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFD
SEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMP
NEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTH
EDYMEGILEVQAKKKANLQYYA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcaggaaatgaatctgctgccgacgcccgagagtccagtgactcggcaggagaagatg
gcgaccgtgtgggatgaagctgagcaagatggcattggggaggaggtgctcaagatgtcc
acggaagagattgtccagcgcacacggctgttagacagcgagatcaagatcatgaagagt
gaagtattgcgagtcacccatgaactccaagccatgaaagacaaaatcaaagagaacagt
gagaaaatcaaagtgaacaaaaccctgccgtaccttgtctccaatgtcatcgagttgctg
gacgttgaccccaatgaccaggaggaggatggtgccaacattgacctggactctcagagg
aagggcaagtgtgcggtgatcaaaacttctacccgacagacatacttcctgccagtgatt
gggttggtggatgcagaaaagctgaagccaggagacctggtgggtgtgaacaaagactcc
tatctgatcctggagaccctgcccactgaatatgactctcgggtgaaggccatggaggtg
gacgagcggcccacggagcaatacagtgacatcgggggcctggacaagcagatccaggag
ctggtggaagccattgtcttgcctatgaaccacaaagagaagtttgagaacttgggtatc
cagcccccaaaaggagtgctgatgtatgggccgcctggaacagggaagactctgcttgcc
cgagcctgtgctgctcagaccaaggccaccttcttgaagctggcaggccctcagctggta
cagatgtttattggagatggcgccaagctggtccgtgatgcttttgccctggccaaggag
aaggcaccatctattattttcatagacgaattggatgccattggtaccaaacgcttcgac
agtgaaaaggcaggagaccgagaggtgcagaggaccatgctggagctactgaaccagctg
gacggctttcagcccaacactcaagtgaaggtaattgcagccactaacagggtggacatc
ctggatccagccctgctgcgctcaggccgcctagaccgcaagattgagtttccaatgccc
aacgaggaggccagagccagaatcatgcagatccactcacggaagatgaatgtcagtcct
gatgtgaactatgaagagctggctcggtgcactgatgacttcaatggagcccagtgcaag
gccgtgtgtgtggaggcgggtatgatcgcattgcgcaggggagccacggaactcactcat
gaggactacatggagggcatcctggaggttcaggccaagaagaaagccaacctacaatac
tatgcctag

KEGG   Mus musculus (mouse): 19184
Entry
19184             CDS       T01002                                 

Gene name
Psmc5, Rp, Rpt6, mSUG, mSUG1
Definition
(RefSeq) protease (prosome, macropain) 26S subunit, ATPase 5
  KO
K03066  26S proteasome regulatory subunit T6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19184 (Psmc5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19184 (Psmc5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19184 (Psmc5)
   05012 Parkinson disease
    19184 (Psmc5)
   05014 Amyotrophic lateral sclerosis
    19184 (Psmc5)
   05016 Huntington disease
    19184 (Psmc5)
   05017 Spinocerebellar ataxia
    19184 (Psmc5)
   05020 Prion disease
    19184 (Psmc5)
   05022 Pathways of neurodegeneration - multiple diseases
    19184 (Psmc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19184 (Psmc5)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     19184 (Psmc5)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 IstB_IS21 AAA_18 Mg_chelatase AAA_3 ATPase PhoH AAA_28 Sigma54_activat AAA_24 AAA_14 AAA_7 AAA_17 AAA_25 Parvo_NS1 DUF815 RNA_helicase TsaE AAA_19 AAA_11 Zeta_toxin Prominin
Other DBs
NCBI-GeneID: 19184
NCBI-ProteinID: NP_032976
MGI: 105047
Ensembl: ENSMUSG00000020708
Vega: OTTMUSG00000003290
UniProt: P62196
Position
11; 11 E1
AA seq 406 aa
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcttgatgggccagagcagatggaactggaagaggggaaggcaggcagtggactc
cgtcaatattatctgtccaagattgaagaactccagttgattgtaaatgataagagccag
aatctccgtagactgcaggcacagaggaatgagctgaatgcaaaagttcgcctgttgcgg
gaggagctgcagctgttgcaggaacagggctcctacgttggagaagtcgtgagggccatg
gataagaaaaaagtattggtcaaggtccatcctgagggcaaatttgttgttgatgtggac
aagaacattgatatcaacgatgtgacgcccaattgtcgggtcgctctaagaaatgacagc
tacactctgcataagatcttacctaacaaggtggaccctttggtgtcactaatgatggtg
gagaaggtgccagactcaacctacgagatgattggcggcctggacaagcagatcaaggag
attaaagaagtgatcgagctgcccgtgaagcaccccgagctctttgaagcactgggcatc
gcacagccaaagggagtcctgctctacggacccccaggcactgggaagacattgttggcc
cgcgctgtggctcatcatacagactgtacctttattcgtgtctctggctctgaactggta
cagaaattcatcggggaaggggcaagaatggtgagggagctgtttgtcatggcccgagaa
catgctccatccatcatcttcatggacgagattgactctattggctcctcacggctggag
gggggctctggaggcgacagtgaggtacagcgcacgatgctggaactgctcaatcagctg
gatggctttgaggccaccaagaatatcaaggttatcatggctactaataggattgatatc
ctggactctgccctgcttcgtcctgggaggattgacagaaaaattgaattcccacccccc
aacgaggaggcccggctggacattttgaaaatccactctcggaaaatgaacttgaccagg
gggatcaacctgaggaaaattgctgagttgatgccgggagcttcaggggctgaagtgaag
ggtgtgtgcacagaagctggcatgtacgccctgcgggaacggcgtgtccacgtcactcag
gaggactttgagatggcagtagctaaggtcatgcaaaaggatagtgagaaaaacatgtcc
atcaagaagctatggaagtga

KEGG   Mus musculus (mouse): 19185
Entry
19185             CDS       T01002                                 

Gene name
Psmd4, Af, Af1, Mcb1, ang, angiocidin
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
  KO
K03029  26S proteasome regulatory subunit N10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19185 (Psmd4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19185 (Psmd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19185 (Psmd4)
   05012 Parkinson disease
    19185 (Psmd4)
   05014 Amyotrophic lateral sclerosis
    19185 (Psmd4)
   05016 Huntington disease
    19185 (Psmd4)
   05017 Spinocerebellar ataxia
    19185 (Psmd4)
   05020 Prion disease
    19185 (Psmd4)
   05022 Pathways of neurodegeneration - multiple diseases
    19185 (Psmd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19185 (Psmd4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     19185 (Psmd4)
SSDB
Motif
Pfam: VWA_2 UIM VWA Ssl1 RAP80_UIM
Other DBs
NCBI-GeneID: 19185
NCBI-ProteinID: NP_032977
MGI: 1201670
Ensembl: ENSMUSG00000005625
Vega: OTTMUSG00000019658
UniProt: O35226
Position
3 F2.1; 3 40.74 cM
AA seq 376 aa
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATPGTEDSDDALLKMTINQQEFGRPGLPDLSSMTEEEQIAYAMQMSLQGTEF
SQESADMDASSAMDTSDPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALAS
QATKDGKNDKKEEEKK
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggtgttggagagcactatggtttgtgtggacaacagtgagtacatgcggaacggagac
ttccttcccacccggctgcaggcccagcaggatgccgtcaacattgtatgtcactcaaag
acccgaagcaaccctgagaataacgtgggcctgatcacactggccaatgactgtgaggtg
ctgaccacactcaccccggacactggccgtatcctctccaagctccacactgtccaaccc
aaaggcaagatcaccttctgcactggcatccgcgtggcccacttggctctgaagcaccgg
cagggcaagaatcacaagatgcgcatcatcgcctttgtcggtagccctgtggaggacaac
gagaaggatctggtgaaactagctaaacgccttaagaaagaaaaagtgaatgttgacatc
attaattttggggaagaggaggtgaacacagagaagctgacagcctttgtgaacacactg
aatggcaaggatggaactgggtcccatctagtgacagtgcctcctggacctagcttggct
gatgctctcatcagttctcctattctggctggtgaaggcggtgccatgctgggtcttggt
gccagtgactttgagtttggagtagatcccagtgctgatcctgaattggccctggccctt
cgagtctctatggaagagcagcggcagcggcaggaggaagaggcacggcgggccgctgcg
gcctctgcagctgaggctggaattgctacacctgggactgaagactcggatgacgcccta
ctgaagatgaccatcaaccagcaggagtttggccgtcctgggcttccagacctaagcagc
atgactgaggaagagcagatcgcctacgccatgcagatgtccctgcagggaacagagttt
agccaagaatcggctgacatggatgccagctcagccatggacacatctgatccagtcaag
gaggaggatgactatgacgtcatgcaggacccggagttccttcagagcgtcctagagaac
cttccaggtgtggatcccaacaatgcagccattcgaagtgtcatgggggctctggcctcc
caggccaccaaggatggcaagaatgacaagaaagaggaagagaagaagtga

KEGG   Mus musculus (mouse): 20422
Entry
20422             CDS       T01002                                 

Gene name
Sem1, DS, DSS1, Shf, Shfdg, Shfdg1, Shfg, Shfm, Shfm1
Definition
(RefSeq) SEM1, 26S proteasome complex subunit
  KO
K10881  26 proteasome complex subunit DSS1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu03440  Homologous recombination
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    20422 (Sem1)
  09124 Replication and repair
   03440 Homologous recombination
    20422 (Sem1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    20422 (Sem1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    20422 (Sem1)
   05012 Parkinson disease
    20422 (Sem1)
   05014 Amyotrophic lateral sclerosis
    20422 (Sem1)
   05016 Huntington disease
    20422 (Sem1)
   05017 Spinocerebellar ataxia
    20422 (Sem1)
   05020 Prion disease
    20422 (Sem1)
   05022 Pathways of neurodegeneration - multiple diseases
    20422 (Sem1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    20422 (Sem1)
   04131 Membrane trafficking [BR:mmu04131]
    20422 (Sem1)
   03051 Proteasome [BR:mmu03051]
    20422 (Sem1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20422 (Sem1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     20422 (Sem1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    20422 (Sem1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     20422 (Sem1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     20422 (Sem1)
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 20422
NCBI-ProteinID: NP_033195
MGI: 109238
Ensembl: ENSMUSG00000042541
Vega: OTTMUSG00000024492
UniProt: P60897 Q3TV35
Position
6; 6 A1
AA seq 70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtccgaaaagaagcagccggtcgacttgggtctcttggaagaggacgacgagttcgag
gagtttcccgcggaagactgggctggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaagatgacttctctaaccagttacgtgctgagctg
gagaagcacggctacaagatggagacatcatag

KEGG   Mus musculus (mouse): 21762
Entry
21762             CDS       T01002                                 

Gene name
Psmd2, 9430095H01Rik, AA407121, TEG-190, Tex190
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    21762 (Psmd2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    21762 (Psmd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    21762 (Psmd2)
   05012 Parkinson disease
    21762 (Psmd2)
   05014 Amyotrophic lateral sclerosis
    21762 (Psmd2)
   05016 Huntington disease
    21762 (Psmd2)
   05017 Spinocerebellar ataxia
    21762 (Psmd2)
   05020 Prion disease
    21762 (Psmd2)
   05022 Pathways of neurodegeneration - multiple diseases
    21762 (Psmd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    21762 (Psmd2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     21762 (Psmd2)
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep HEAT_2 THAP
Other DBs
NCBI-GeneID: 21762
NCBI-ProteinID: NP_598862
MGI: 1096584
Ensembl: ENSMUSG00000006998
Vega: OTTMUSG00000036488
UniProt: Q8VDM4 Q3TKV1
Position
16; 16 A3
AA seq 908 aa
MEEGGRDKTPVQSQQPSATTPSGADEKSSGKERRDAGEKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKC
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKAQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaggagggtggacgagacaagacacccgtgcagtcccaacagccctccgcgacaacc
cccagcggcgcggacgagaagtcgagtggcaaggagcgaagggatgccggggaaaaagac
aaagagcaggagctgtctgaggaggacaaacagcttcaagatgaactggagatgctcgtg
gagcgactcggggagaaagatacatctctatatcgaccagctctggaggaactgagaaga
caaattcgttcttctacaacttccatgacttcagtacccaagcctctcaaatttctgcgt
ccacactatggcaaattgaaggaaatctatgagaacatggcccctggggagaataagtgt
tttgcagctgacatcatctctgttttggccatgaccatgagtggtgagcgggagtgcctc
aagtatcggctcgtgggctcccaggaagaactggcgtcatggggccatgaatacgtcaga
catctggcaggagaggtggccaaggagtggcaggagctggatgatgcagagaaagcacag
cgggaaccactgcttaccttggtaaaggaaatcgtcccctacaacatggctcacaatgca
gagcacgaggcttgtgacctgctcatggaaattgagcaggtggacatgctagagaaggac
attgatgagaacgcctacgccaaggtctgcctctatctcaccagttgtgtgaattatgta
ccagaacctgagaactctgccctcctgcgctgcgccttgggcgtgttccgaaagtttagc
cgtttccctgaagctctgagattggcactgatgctcaatgacatggaactggtagaagac
attttcacttcctgcaaagatgtggtggtccagaagcagatggcattcatgctgggtcgg
catggagtgttcctggagctgagtgaagatgtagaggaatatgaagacctcacagaaatc
atgtccaatgtccagctcaacagcaacttcttggctttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaataacaggtttggtggc
agtggctctcaagtggattctgcacgaatgaacctagcctcctcttttgtaaatggcttt
gtgaatgcagcctttggtcaagataaactactgactgatgatggcaacaaatggctttac
aagaacaaggaccatgggatgctaagtgctgctgcgtctcttggcatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtatctgtactcctctgaggactacatc
aagtcaggagctctccttgcctgtggtatcgtgaattctggagtccggaatgagtgtgat
cctgccctggcactgctttcagactatgttctccataacagcaataccatgagacttggc
tccatctttgggctaggtttggcctatgctggctctaatcgggaagatgttctaacactg
ctgctacctgtaatgggagattccaagtccagcatggaggtggcaggtgtgacggctcta
gcttgtgggatgatagcagtggggtcctgcaatggagatgtcacttccaccatccttcag
accatcatggagaaatctgagactgagctcaaggatacctatgctcgttggcttcctctt
ggcctgggcctcaatcacttggggaaaggcgaagctattgaggccatcctggctgccttg
gaggtggtgtcagagccattccgcagttttgccaataccctggtggatgtatgtgcctat
gcaggctctgggaatgtgctgaaggttcagcagctcctccacatctgtagtgagcacttt
gactctaaggaaaaggaggaagacaaagacaagaaggaaaagaaggacaaggacaagaag
gaagcccctgctgacatgggagcacatcagggagtagctgttctgggcattgcacttatt
gctatgggggaagagattggtgcagagatggcattgcgaacttttggtcacttgctgaga
tatggggagcctaccctccgtcgcgctgtacctttagcactggcactaatttctgtttca
aatccacgactcaacatcctggatacgctaagcaaattctctcatgatgctgatccagaa
gtttcctataactccatctttgctatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgttgcgccagttagctcaatatcatgccaaggaccccaataacctcttc
atggtgcgcttggcacagggcttgacacatttagggaagggcacacttaccctctgcccc
tatcacagtgatcggcagctcatgagtcaagtagcggtggcagggctactcacggtgctt
gtttctttcctggatgttcgaaacatcatcctaggcaagtctcactatgtcctgtatggg
ctggtagccgccatgcagcctcggatgctggttacatttgatgaggagctgcgaccattg
ccagtttctgtccgtgtgggtcaggcagtggatgtggtgggccaggctgggaagccaaaa
acaatcacagggttccagactcatacaacgccagtgttgctggcccatggggagcgggca
gagttggccactgaggagtttcttcctgtcacccccattctggaaggctttgttattctt
cggaagaaccccaactatgatctttga

KEGG   Mus musculus (mouse): 22123
Entry
22123             CDS       T01002                                 

Gene name
Psmd3, AI255837, Ant, AntP91a, D11Bwg1349e, Ps, Psd3, Tsta, Tstap91a
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    22123 (Psmd3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    22123 (Psmd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22123 (Psmd3)
   05012 Parkinson disease
    22123 (Psmd3)
   05014 Amyotrophic lateral sclerosis
    22123 (Psmd3)
   05016 Huntington disease
    22123 (Psmd3)
   05017 Spinocerebellar ataxia
    22123 (Psmd3)
   05020 Prion disease
    22123 (Psmd3)
   05022 Pathways of neurodegeneration - multiple diseases
    22123 (Psmd3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    22123 (Psmd3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     22123 (Psmd3)
SSDB
Motif
Pfam: Rpn3_C PCI CSN8_PSD8_EIF3K TPR_2 TSKS
Other DBs
NCBI-GeneID: 22123
NCBI-ProteinID: NP_033465
MGI: 98858
Ensembl: ENSMUSG00000017221
Vega: OTTMUSG00000006404
UniProt: P14685
Position
11 D; 11 62.39 cM
AA seq 530 aa
MKQEGSARRRGADKAKPPPGGEQEPPPPAPQDVEMKEEAAAGSGSTGEGDGKAAATEHSQ
RELDTVTLEDIKEHVRQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFTSN
NATRDFLLPFLEEPMDTEADLQFRPRTGKAASAPLLPEVEAYLQLLMVIFLMNSKRYKEA
QKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDA
DGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSE
ARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLT
QAVRTGNLAKFNQVLDQFGEKFQTDGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQ
KLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCL
DIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgaagcaggagggctcggcgcggcgccgaggcgccgacaaggcaaagccgccgccggga
ggggaacaagaaccgccgccaccggccccccaggatgtggagatgaaagaggaggcagca
gctgggagcggctccacgggggagggagacggcaaggcagctgcgaccgagcactcccag
agagagctggacactgtcaccttagaagacatcaaagagcacgtgagacagctagagaag
gctgtttccggcaaggagcctcggttcgtgctgagggcgctgcggatgctgccgtccacg
tcacgccgcctcaaccactatgttctgtacaaggctgtgcatggcttcttcacctccaat
aacgccactcgagacttcttgctacccttcctagaagaacccatggacacagaagccgac
ctgcagtttcgtcctcgcacaggaaaagcggcatcagcgcctctcctgcctgaggtggaa
gcctacctgcagctgctcatggtcatcttcctgatgaacagcaagcgctacaaagaggca
cagaaaatctctgatgacctgatgcagaagatcagcactcagaaccgccgagccctggac
ctcgtagctgccaagtgttactattatcacgcccgggtctatgagttcctggacaagctg
gatgtggtgcgcagcttcttgcatgcccggctccggacagccaccctgcggcacgatgct
gacggacaggctacccttttgaacctcctgcttcggaattacctgcactacagcttgtat
gaccaggctgagaagctggtatccaagtctgtgttccctgagcaagccaacaacaatgag
tgggccaggtacctctattacacagggcgaatcaaggctatccagctggagtactctgaa
gcccggagaacgatgaccaatgcccttcgaaaggctccacagcacacagctgttggcttc
aaacagacggtgcacaagcttctgatcgtggtagagctcctgctgggggagatcccagac
cgcctgcagttccgccagccctccctaaagcgctccctcatgccctacttccttctcacc
caagctgttaggacaggaaatcttgccaagttcaaccaagttctggatcagtttggggag
aagtttcaaacggatgggacctacaccctgattatccgactgcgacacaatgtgatcaag
acaggtgtgcgcatgatcagcctgtcctattcccggatctccctggccgacatcgcccag
aagctgcagctggatagcccagaagatgcagagttcattgtcgccaaggccatccgggac
ggcgtgattgaggccagcatcaatcacgagaagggatacgtccaatccaaagagatgatt
gacatctattccacccgggagccccagctggccttccaccagcgcatctccttctgtctg
gacatccacaacatgtctgtcaaggccatgcgctttcctcccaaatcctacaacaaggac
ctggagtctgcagaggagcggcgagagcgggagcagcaggacctggagtttgccaaggag
atggcggaggatgacgacgacagcttcccctga

KEGG   Mus musculus (mouse): 23996
Entry
23996             CDS       T01002                                 

Gene name
Psmc4, CIP, CIP21, MIP2, MIP224
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, ATPase, 4
  KO
K03063  26S proteasome regulatory subunit T3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    23996 (Psmc4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    23996 (Psmc4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23996 (Psmc4)
   05012 Parkinson disease
    23996 (Psmc4)
   05014 Amyotrophic lateral sclerosis
    23996 (Psmc4)
   05016 Huntington disease
    23996 (Psmc4)
   05017 Spinocerebellar ataxia
    23996 (Psmc4)
   05020 Prion disease
    23996 (Psmc4)
   05022 Pathways of neurodegeneration - multiple diseases
    23996 (Psmc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    23996 (Psmc4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     23996 (Psmc4)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase AAA_14 Mg_chelatase NTPase_1 AAA_18 AAA_28 IstB_IS21 AAA_33 Sigma54_activat NACHT TIP49 CENP-F_leu_zip AAA_3 ATPase_2 TsaE AAA_7 AAA_24 AAA_17 AAA_25 Zeta_toxin DUF3450 NB-ARC DivIVA Parvo_NS1 ABC_tran
Other DBs
NCBI-GeneID: 23996
NCBI-ProteinID: NP_036004
MGI: 1346093
Ensembl: ENSMUSG00000030603
Vega: OTTMUSG00000025054
UniProt: P54775
Structure
PDB: 
3AJI

Position
7 A3; 7 16.11 cM
AA seq 418 aa
MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagataggcattttggtggaaaagattcaggatgagattccagcactgtccgtg
tctcggccgcagaccggcctgtcctttctgggacccgaacctgaagacctggaggacctg
tacagccgctacaagaagctgcagcaggagctggagttcctggaagtgcaggaggagtat
atcaaggacgagcagaagaacctgaagaaggaattcctccacgcccaggaggaggtgaag
cggatccagagcatccccttggtcatcggtcagttcttggaagctgtggatcagaacaca
gccatcgtgggctccaccacaggctctaactattatgtgcgcatcctgagtaccatcgac
cgggagctgctcaagcccaacgcctcggtggccctgcacaagcacagcaatgccctggtg
gacgtgctgcctcccgaggccgacagcagcatcatgatgctcacctcagaccagaagcca
gatgtgatgtatgccgatatcggaggcatggacatccagaagcaggaggtgagggaggct
gtggaactcccgcttacacacttcgagctgtacaagcagattggcatcgatcctccccga
ggtgtcctcatgtatggccctcctggctgtggaaagacaatgttagcaaaggctgtggca
catcacacgacagctgcatttatccgtgtggtgggctcggagtttgttcagaagtacctg
ggtgagggcccccggatggtccgggatgtgttccgcctagctaaggagaatgcacctgcc
atcatcttcatagatgaaattgatgccattgccaccaagagattcgatgcccagacagga
gctgacagggaggttcagaggatcctgctggaactactgaatcaaatggatggatttgac
cagaacgtcaatgtgaaggtaatcatggccacaaacagagcagacaccttggatccagct
ctactgcggccaggacgcctggaccgaaaaattgaattcccactccctgaccgtcgccag
aagaggttgattttctccaccatcaccagcaaaatgaacctctctgaggaggtcgacctg
gaagactatgtggcccgtccagataagatttcaggagccgatatcaactccatctgtcag
gagagtggaatgttggctgtccgtgagaaccgctacattgtcctggccaaggacttcgag
aaagcatacaagaccgtgatcaagaaagatgaacaggaacatgaattttacaagtga

KEGG   Mus musculus (mouse): 23997
Entry
23997             CDS       T01002                                 

Gene name
Psmd13, S1, S11
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
  KO
K03039  26S proteasome regulatory subunit N9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    23997 (Psmd13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    23997 (Psmd13)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23997 (Psmd13)
   05012 Parkinson disease
    23997 (Psmd13)
   05014 Amyotrophic lateral sclerosis
    23997 (Psmd13)
   05016 Huntington disease
    23997 (Psmd13)
   05017 Spinocerebellar ataxia
    23997 (Psmd13)
   05020 Prion disease
    23997 (Psmd13)
   05022 Pathways of neurodegeneration - multiple diseases
    23997 (Psmd13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    23997 (Psmd13)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     23997 (Psmd13)
SSDB
Motif
Pfam: PCI Rpn9_C PARP_reg
Other DBs
NCBI-GeneID: 23997
NCBI-ProteinID: NP_036005
MGI: 1345192
Ensembl: ENSMUSG00000025487
Vega: OTTMUSG00000023443
UniProt: Q9WVJ2 B2RT97
Position
7; 7 F5
AA seq 376 aa
MKDVPAFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLEVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQATKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRDTDRQWLIDTLYAF
NSGAVDRFQTLKCAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLELWCTDV
KSMEMLVEHQAQDILT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaggatgtgccggccttcttacagcagagtcagagctccgggccgggccaggctgcc
gtttggcaccgtttggaagagctgtacacgaagaagttgtggcatcagctgacacttgag
gtgcttgattttgtgcaggacccatgctttgcccaaggagatggtctcattaagctttat
gaaaacttcatcagtgagtttgagcacagggtaaaccctctgtccctggtagaaataatt
ctccatgtggttagacagatgaccgatcctaatgtggctcttacttttctggaaaagact
cgtgagaaggtaaaaagtagtgatgaagccgtgatcttgtgtaagacggcaatcggagct
ctaaaattaaacatcggcgatctgcaggctacaaaggaaaccattgaagatgttgaagag
atgctcaacaatctccctggtgtgacgtccgttcacagtcgtttctatgatctctccagt
aaatactatcaaacaatcggaaaccacgcgtcctactacaaagatgctctacggtttctg
ggctgtgtggatatcaaggacctgccagtgtcagaacagcaagagagagccttcacactg
gggcttgctggacttctcggagagggagtttttaactttggagaacttctcatgcaccct
gtgctggagtcactgagggacactgaccggcagtggctgattgacaccctgtacgctttc
aatagcggtgctgtggataggttccagacactgaagtgtgcctggggccagcagcctgac
ttagcagccaacgaagcccagcttctgaggaagatccagctgttgtgccttatggagatg
actttcacacggcctgccaaccacagacaactcacttttgaagaaattgccaaaagtgcc
aaaatcactgtcaacaaggtggagttgctggtgatgaaggcactctcggtggggctggtg
agaggcagcatagacgaggtggacaagcgggttcacatgacgtgggtgcagccgcgagtg
ctggatttgcagcagatcaaggggatgaaggaccgtctggagctttggtgcactgatgtg
aagagcatggagatgctggtggaacaccaggctcaggacatcctcacctag

KEGG   Mus musculus (mouse): 56436
Entry
56436             CDS       T01002                                 

Gene name
Adrm1, 1110063P18Rik, 2510006J17Rik, AA408205, ARM, ARM-1, AU043535, Arm1, Gp11, Gp110, Rp, Rpn13
Definition
(RefSeq) adhesion regulating molecule 1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    56436 (Adrm1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    56436 (Adrm1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    56436 (Adrm1)
   05012 Parkinson disease
    56436 (Adrm1)
   05014 Amyotrophic lateral sclerosis
    56436 (Adrm1)
   05016 Huntington disease
    56436 (Adrm1)
   05017 Spinocerebellar ataxia
    56436 (Adrm1)
   05020 Prion disease
    56436 (Adrm1)
   05022 Pathways of neurodegeneration - multiple diseases
    56436 (Adrm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    56436 (Adrm1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     56436 (Adrm1)
SSDB
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD
Other DBs
NCBI-GeneID: 56436
NCBI-ProteinID: NP_062796
MGI: 1929289
Ensembl: ENSMUSG00000039041
Vega: OTTMUSG00000016265
UniProt: Q9JKV1
Structure
PDB: 
2R2Y 2Z59

Position
2; 2 H4
AA seq 407 aa
MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNECLNNPPMPGSLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSSTSSARATPAPSAPAAASAT
SPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacgacttcaggcgctctgttcccaagcctggtgcccggctctcgggggtcttctacc
aaatatttggtggagttccgggcaggaaaaatgtcattaaaaggaactacggtcacccca
gataaacggaaaggtctcgtgtacatccagcagacggacgactcccttattcacttctgt
tggaaagacaggacctctgggaccgtggaggatgacttgattatctttcctgatgactgt
gagttcaagcgggtacctcagtgccccagtgggagggtctacgtgctcaagtttaaggca
gggtccaagcggctcttcttctggatgcaggagcccaagactgaccaagatgaggagcac
tgccggaaagtcaacgagtgtctgaacaacccccccatgcctgggtcactgggagcaagt
gggagtagtggccatgagctttcagcactgggcggtgagggtggcctgcagagcctgttg
gggaacatgagtcacagccagcttatgcagctcatcggaccagccggcctgggaggactg
ggtggacttggggccctcactgggccaggcctggccagcttgctggggagcagtggacct
ccagccagcagctcttcatccagctcccggagccagtcggcagccgtcaccccatcctcc
tccacctcttccgctcgcgccaccccagccccttctgccccagcagctgcctcggcaacc
agcccaagccccgcacccagctcaggtaatggaaccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcattctggccactatgaacgtgccggcagggcca
ggaggcagccagcaagtggatctggcgagtgtgctgaccccagagatcatggctcccatc
cttgccaatgcagacgttcaggagcgcctgctgccctacctgccctctggggagtctctg
ccccagactgcagatgagatccagaacacattaacctcgccccagttccagcaggccctg
ggtatgttcagtgcggccttggcctcaggacagcttggccctctcatgtgccagttcggc
cttcctgcagaggctgttgaggccgccaacaaaggtgatgtggaagcatttgccaaagcc
atgcagaacaatgccaaatcggacccaaaggagggcgacacaaaagacaagaaagacgaa
gaagaagatatgagtctagactaa

KEGG   Mus musculus (mouse): 57296
Entry
57296             CDS       T01002                                 

Gene name
Psmd8, 6720456J22Rik, AA407360, AL033291, AL033322, AL033323, C76433
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
  KO
K03031  26S proteasome regulatory subunit N12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    57296 (Psmd8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    57296 (Psmd8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    57296 (Psmd8)
   05012 Parkinson disease
    57296 (Psmd8)
   05014 Amyotrophic lateral sclerosis
    57296 (Psmd8)
   05016 Huntington disease
    57296 (Psmd8)
   05017 Spinocerebellar ataxia
    57296 (Psmd8)
   05020 Prion disease
    57296 (Psmd8)
   05022 Pathways of neurodegeneration - multiple diseases
    57296 (Psmd8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    57296 (Psmd8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     57296 (Psmd8)
SSDB
Motif
Pfam: CSN8_PSD8_EIF3K
Other DBs
NCBI-GeneID: 57296
NCBI-ProteinID: NP_080821
MGI: 1888669
Ensembl: ENSMUSG00000030591
Vega: OTTMUSG00000043396
UniProt: Q9CX56 Q9CPS5
Position
7; 7 B1
AA seq 353 aa
MFIKGRAAKTPRGEPRRSSRGGRKLAVVAPPPVLGSTSRPHFRRESIARRRCRKSGRRLA
ASRKMAATAATVNGSTTVSSSGPAATSVGILQAAAGMYEQLKDEWNRKNPNLSKCGEELG
RLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFD
YKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLM
EGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPK
KMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgttcattaagggtcgggctgcgaagacaccccgaggagagccgcggcgctcctcccgc
ggggggcggaaactggcagtggtagctccgcctccagttttgggctccacctcccggcct
catttccgccgggagtccattgcccggcgtcgctgccgtaagtcgggtcggcggcttgcc
gcatcacggaagatggcggccacagcggctacggtgaacgggtcgaccaccgtctcgagc
tccggacccgcggccacctcggtcgggatcctgcaggcagcggccggcatgtacgagcaa
ctcaaggacgagtggaaccggaagaacccgaaccttagtaaatgtggagaagaactgggc
cgcctgaagttggttctgcttgagctcaatttcctgccaaccacggggaccaaactgact
aaacagcaactcattctggcccgtgacattctggagatcggggcccagtggagcatcctg
tgcaaagacattccctccttcgagcgctacatggcccaactcaaatgctactactttgat
tacaaagaacagcttcctgagtcagcctatatgcaccagctcctgggcctcaatctcctc
ttcctgctatctcagaaccgagtggctgagttccacacagaattagaacgattacctgcc
aaggacatccagaccaatgtctacatcaaacaccctgtttccctcgagcaatacctcatg
gagggtagctacaacaaggtattcctggctaaggggaacatccctgccgaaagctacacc
ttcttcattgacatcctgctggataccatcagggatgaaatcgcaggatgcattgagaag
gcctatgagaaaatcctttttgctgaggctacccggatcctcttcttcagcacacccaaa
aagatgacagactatgccaagaagcgaggttgggtgctgggccctaacaactactacagc
tttgccagccagcagcagaagccagaagacagcaccatcccctctactgaactggccaaa
caagtcatcgagtatgcccggcagctggagatgattgtctga

KEGG   Mus musculus (mouse): 59029
Entry
59029             CDS       T01002                                 

Gene name
Psmd14, 2610312C03Rik, 3200001M20Rik, AA986732, PO, Pa, Pad1, Poh1, rpm11
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    59029 (Psmd14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    59029 (Psmd14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    59029 (Psmd14)
   05012 Parkinson disease
    59029 (Psmd14)
   05014 Amyotrophic lateral sclerosis
    59029 (Psmd14)
   05016 Huntington disease
    59029 (Psmd14)
   05017 Spinocerebellar ataxia
    59029 (Psmd14)
   05020 Prion disease
    59029 (Psmd14)
   05022 Pathways of neurodegeneration - multiple diseases
    59029 (Psmd14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    59029 (Psmd14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    59029 (Psmd14)
   03051 Proteasome [BR:mmu03051]
    59029 (Psmd14)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M67
   59029 (Psmd14)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    59029 (Psmd14)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     59029 (Psmd14)
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Other DBs
NCBI-GeneID: 59029
NCBI-ProteinID: NP_067501
MGI: 1913284
Ensembl: ENSMUSG00000026914
Vega: OTTMUSG00000013076
UniProt: O35593
Position
2; 2 C1.3
AA seq 310 aa
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccagggcccacctaca
gatgctcctgccgtggacacagcagaacaagtttatatctcttccttggccttgctaaag
atgttaaaacatggtcgtgctggagtgcctatggaagttatgggtctaatgcttggtgaa
tttgttgatgattacaccgtcagagtgattgatgtgtttgctatgccacagtcaggaact
ggtgtcagtgttgaagcagttgatccagtgttccaagccaaaatgttggatatgctgaaa
caaacaggaaggcccgagatggttgttggttggtatcacagtcaccctggctttggctgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttc
agactgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacgacttcaaat
ctgggccacttaaacaagccatctatccaggcattaattcacggactaaacagacattat
tactccatcactattaattaccggaaaaatgaactggaacagaagatgctgttaaatttg
cataagaagagttggatggaaggattgacacttcaggactacagtgaacactgtaaacac
aatgaatcggtggtaaaagaaatgttggaattagccaagaattataataaggctgtggaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggatccc
aaacgtcatttggaagaacatgtggatgtgcttatgacttcaaatattgtccagtgtttg
gccgcaatgttggatactgttgtatttaaataa

KEGG   Mus musculus (mouse): 66413
Entry
66413             CDS       T01002                                 

Gene name
Psmd6, 2400006A19Rik
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
  KO
K03037  26S proteasome regulatory subunit N7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    66413 (Psmd6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    66413 (Psmd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66413 (Psmd6)
   05012 Parkinson disease
    66413 (Psmd6)
   05014 Amyotrophic lateral sclerosis
    66413 (Psmd6)
   05016 Huntington disease
    66413 (Psmd6)
   05017 Spinocerebellar ataxia
    66413 (Psmd6)
   05020 Prion disease
    66413 (Psmd6)
   05022 Pathways of neurodegeneration - multiple diseases
    66413 (Psmd6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    66413 (Psmd6)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     66413 (Psmd6)
SSDB
Motif
Pfam: RPN7 PCI
Other DBs
NCBI-GeneID: 66413
NCBI-ProteinID: NP_079826
MGI: 1913663
Ensembl: ENSMUSG00000021737
Vega: OTTMUSG00000027779
UniProt: Q99JI4
Position
14; 14 A1
AA seq 389 aa
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVREELMAAVRENNMAPYYEALCKS
LDWQMDVDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCQIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAIVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVDFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccgctagaaaacctagaagaagagggactgcccaagaaccccgacctgcgcatcgcg
cagctgcggtttctgcttagcctgccggagcaccgcggggacgcggcggtgcgcgaggag
ttgatggcggccgtccgggaaaacaatatggctccttattatgaagccttgtgtaaatcc
ctcgactggcagatggacgtggatctcctgagtaaaatgaagaaagcaaacgaagaagag
ttgaaacgtttggatgaggagctggaggatgcagagaagaatctgggagaaagtgaaatt
cgagatgcaatgatggcaaaagcagagtacctctgtcagataggtgacaaggaaggagct
ttgacagcttttcgcaagacatacgataagactgtggccctgggtcaccgcctggatatt
gtattctatctcctaaggatcggactcttttatatggataatgacctcattactcgaaac
acagaaaaggccaaaagcctgatagaggaaggcggagactgggacaggcgaaacaggctg
aaagtgtaccagggcttatattgtgtggctatccgtgacttcaaacaggcagcagagctc
tttctcgacactgtttctacgtttacatcgtatgagctcatggattacaagacatttgtg
acttacactgtttacgtcagtatgatcgccttagaaaggccggacctcagggaaaaggtc
attaaaggggcagagatccttgaagtgttgcacagtcttccagcagttcggcagtatctg
ttttctctctatgaatgccgttattcagtttttttccaatcattagcaatcgtggaacag
gaaatgaaaaaggattggctttttgcgcctcattaccgatactatgtaagagaaatgaga
atccatgcgtacagccagctgctggaatcatataggtcattaaccctcggctatatggca
gaagcttttggtgtgggtgtggacttcattgaccaggagctgtccaggtttattgctgct
ggaagactccactgcaaaattgataaagtaaatgaaatcgtggagaccaacagacctgat
agcaagaactggcagtatcaagaaaccatcaagaaaggagacttgctgctaaacagggtt
cagaaattatccagagtaattaacatgtaa

KEGG   Mus musculus (mouse): 66997
Entry
66997             CDS       T01002                                 

Gene name
Psmd12, 1500002F15Rik, AI480719, P5, P55
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    66997 (Psmd12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    66997 (Psmd12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66997 (Psmd12)
   05012 Parkinson disease
    66997 (Psmd12)
   05014 Amyotrophic lateral sclerosis
    66997 (Psmd12)
   05016 Huntington disease
    66997 (Psmd12)
   05017 Spinocerebellar ataxia
    66997 (Psmd12)
   05020 Prion disease
    66997 (Psmd12)
   05022 Pathways of neurodegeneration - multiple diseases
    66997 (Psmd12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    66997 (Psmd12)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     66997 (Psmd12)
SSDB
Motif
Pfam: PCI RPN5_C Hydrophob_seed SIX1_SD
Other DBs
NCBI-GeneID: 66997
NCBI-ProteinID: NP_080170
MGI: 1914247
Ensembl: ENSMUSG00000020720
Vega: OTTMUSG00000003659
UniProt: Q9D8W5
Position
11; 11 E1
AA seq 456 aa
MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPV
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTENLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESDKWQQALKSVVLYVILAPFDNEQSDLVHRISSDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGVELRKGSSETPATDVFSSTEEGEKRWKDLKSRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGVINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcggacggtggctcggagcgggccgatgggcgcattgtgaagatggaagtggactac
agcgccacggtggaccagcgcctgcctgagtgcgagaagctggccaaggaagggcggctt
caagaagtcatcgaaacccttctctctctagaaaagcagacccggactgcctctgacatg
gtgtccacgtcccgcatcttggttgcagtagtgaaaatgtgctatgaggctaaagaatgg
gacttacttaatgaaaatattatgcttctgtcaaaacgacggagtcagttaaaacaagca
gttgcaaaaatggttcagcagtgctgtacttacgtggaggagatcacagacctgccagtc
aagctgcgattgattgatactctgcggatggttacagaaggaaagatttatgttgaaatt
gagcgtgctcggctgactaaaaccttagcaactattaaagagcaaaatggcgatgtgaaa
gaggctgcctccatccttcaagagttacaggtggaaacctatgggtccatggagaagaag
gagcgagtggaattcattctggagcagatgagactctgcctagctgtgaaggattacatt
cgcacacagatcattagcaaaaaaattaataccaaattcttccaagaagaaaacacagag
aacttgaagttgaagtactataacttaatgattcagctggatcagcacgaggggtcctat
ctgtccatctgcaaacactacagagccatctatgacactccctgcattcaggcagaaagt
gacaagtggcagcaggctctgaaaagtgttgttctctatgttatcctggctccttttgac
aatgagcaatcagatttggttcaccggataagcagtgacaagaagctggaagaaattccc
aaatacaaggatctgctgaagctttttaccaccatggagctgatgcgctggtccactctt
gttgaggactatggggtggagctgcgaaaaggctcctcagagaccccggcgactgacgtt
ttcagctctacagaagaaggggaaaagaggtggaaagacttgaagagcagagtggtggag
cacaacatcagaattatggccaagtactacactcggataacaatgaaaaggatggcacaa
cttctggatctctctgtggatgagtcagaggctttcctctcgaatctagtcgttaacaag
accatctttgctaaagtagacaggttggctggagtcatcaacttccagagacccaaggat
ccaaataatttattaaatgactggtctcagaaactgaactcgctgatgtctctggttaac
aaaacgacacacctcatagccaaagaggagatgatacataatctacaatga

KEGG   Mus musculus (mouse): 67089
Entry
67089             CDS       T01002                                 

Gene name
Psmc6, 2300001E01Rik, AI451058
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, ATPase, 6
  KO
K03064  26S proteasome regulatory subunit T4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    67089 (Psmc6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    67089 (Psmc6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67089 (Psmc6)
   05012 Parkinson disease
    67089 (Psmc6)
   05014 Amyotrophic lateral sclerosis
    67089 (Psmc6)
   05016 Huntington disease
    67089 (Psmc6)
   05017 Spinocerebellar ataxia
    67089 (Psmc6)
   05020 Prion disease
    67089 (Psmc6)
   05022 Pathways of neurodegeneration - multiple diseases
    67089 (Psmc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    67089 (Psmc6)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     67089 (Psmc6)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_2 AAA_22 RuvB_N AAA_18 AAA_33 Prot_ATP_OB_N DUF815 AAA_7 AAA_14 AAA_3 RNA_helicase TIP49 IstB_IS21 Mg_chelatase TPR_MLP1_2 AAA_11 TsaE Wtap AAA_24 ATPase AAA_25 NACHT AAA_28 AAA_19 Med4
Other DBs
NCBI-GeneID: 67089
NCBI-ProteinID: NP_080235
MGI: 1914339
Ensembl: ENSMUSG00000021832
UniProt: P62334 Q14AQ1
Position
14; 14 C1
AA seq 389 aa
MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggaccctagagataaggcgcttcaggactatcgcaagaagctgctagagcacaag
gagattgacggccgtcttaaggagctaagggaacaattaaaagaacttaccaagcagtat
gaaaagtctgaaaatgatttgaaggcactacaaagtgttggacagattgtaggtgaagtg
ctaaaacagttaacagaagaaaaattcatcgttaaagcaacaaatggaccaagatacgtt
gtaggttgtcgtcgtcagcttgacaaaagtaagctgaagccaggaaccagagttgctttg
gatatgaccacactaaccatcatgagatatctgccaagagaggtggatccattggtttat
aacatgtctcacgaggatcctggaaatgtatcttattctgagattggaggcctgtcagaa
cagattcgggagttaagagaggtaatagaattgcctcttacaaatccagaattattccag
cgtgtaggaataatacctccaaaaggctgtttgctctatggaccgccaggcactgggaaa
acactcttggcacgagctgttgccagccagctggactgcaacttcctaaaggttgtatct
agttctattgtagacaagtacattggtgaaagtgctcgtttgattagagaaatgtttaat
tatgccagggaccaccagccatgcatcatttttatggatgaaatagatgctattggtggc
cgtcggttttctgagggaacatcagctgacagagagattcagagaactttaatggagtta
ctaaatcaaatggatggatttgatactctgcatagagttaaaatgatcatggctacaaac
agaccagatacactggatcctgctttgctgcgcccaggaagattagatagaaaaatacat
atcgatttaccaaatgaacaagcaagattagatatattgaaaatccacgcaggacctatt
acaaagcatggtgaaatagattatgaagcaattgtaaagctttcagatggctttaatgga
gcagacctgagaaatgtttgtactgaagcaggtatgtttgcaattcgtgccgatcatgat
tttgtagttcaggaagacttcatgaaagcagtcaggaaagtggctgactccaagaagctg
gagtccaagctggactacaaacctgtgtga

KEGG   Mus musculus (mouse): 67151
Entry
67151             CDS       T01002                                 

Gene name
Psmd9, 1500011J20Rik, 2610202L11Rik, Bridge, Bridge-1, P2, P27
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
  KO
K06693  26S proteasome regulatory subunit N4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    67151 (Psmd9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67151 (Psmd9)
   05012 Parkinson disease
    67151 (Psmd9)
   05014 Amyotrophic lateral sclerosis
    67151 (Psmd9)
   05016 Huntington disease
    67151 (Psmd9)
   05017 Spinocerebellar ataxia
    67151 (Psmd9)
   05020 Prion disease
    67151 (Psmd9)
   05022 Pathways of neurodegeneration - multiple diseases
    67151 (Psmd9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    67151 (Psmd9)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     67151 (Psmd9)
SSDB
Motif
Pfam: Nas2_N PDZ_6 PDZ_2 PDZ GRASP55_65
Other DBs
NCBI-GeneID: 67151
NCBI-ProteinID: NP_080276
MGI: 1914401
Ensembl: ENSMUSG00000029440
Vega: OTTMUSG00000023710
UniProt: Q9CR00
Position
5; 5 F
AA seq 222 aa
MSGEDVPHRAESSEARAAAVSDIQDLMRRKEEIEAEIKANYDVLESQKGIGMNEPLVDCE
GYPRADVDLYQVRTARHNIICLQNDHKALMKQVEEALHQLHARDKEKQARDMAEAREEAM
NRRLASNSPVLPQAFARVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSVQNVGTVVQ
HSEGKPLNVTVIRRGEKHQLRLIPTRWAGKGLLGCNIIPLQR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtcgggtgaagacgttccgcaccgggcagagtcctccgaggcccgtgcggccgcggtc
agcgacatccaggatctgatgcgacgcaaggaggagatcgaggcggagatcaaggctaat
tacgacgtcctggagagccaaaaaggaattggcatgaacgaaccgctggtggactgtgag
ggctatccccgggcggatgtggacttgtaccaggtccgaacagcaaggcacaacatcatc
tgtctccagaatgatcacaaggcactgatgaagcaagtggaggaggccctgcaccagctg
cacgctcgggacaaagagaagcaggctcgggacatggctgaagcccgagaagaggccatg
aaccgcaggctggcctccaacagccccgtcctgccccaggcctttgccagagtgaacagt
atcagccccggttccccagccagtattgcgggcctgcaagtggatgacgaaattgtggag
ttcggctccgtgaacacccaaaacttccagtcagtgcagaacgtgggcactgtggtgcag
catagcgaggggaagcccctgaatgtgacggtgatccgcagaggagagaagcaccagctc
agactgattccaacccgctgggcaggaaaaggactgctgggctgcaacattattcctctc
cagagatga

KEGG   Mus musculus (mouse): 69077
Entry
69077             CDS       T01002                                 

Gene name
Psmd11, 1700089D09Rik, 1810019E17Rik, 2610024G20Rik, 2810055C24Rik, C78232, P44., P44.5, S, S9
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    69077 (Psmd11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    69077 (Psmd11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    69077 (Psmd11)
   05012 Parkinson disease
    69077 (Psmd11)
   05014 Amyotrophic lateral sclerosis
    69077 (Psmd11)
   05016 Huntington disease
    69077 (Psmd11)
   05017 Spinocerebellar ataxia
    69077 (Psmd11)
   05020 Prion disease
    69077 (Psmd11)
   05022 Pathways of neurodegeneration - multiple diseases
    69077 (Psmd11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    69077 (Psmd11)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     69077 (Psmd11)
SSDB
Motif
Pfam: RPN6_N PCI RPN6_C_helix TPR_12 DDRGK DUF2153 AAA_16
Other DBs
NCBI-GeneID: 69077
NCBI-ProteinID: NP_848731
MGI: 1916327
Ensembl: ENSMUSG00000017428
Vega: OTTMUSG00000000212
UniProt: Q8BG32 Q5BKQ9 Q3UWW9
Position
11; 11 B5
AA seq 422 aa
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKK
LT
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcggccgcagcggtggtggagttccagagagcccagtctctactcagcaccgaccgg
gaggcctccatcgacatcctccactccatcgtgaaacgtgacattcaagaaaatgatgag
gaggcagtccaggtcaaagagcagagcatccttgaactgggttctctcctggcgaagact
ggacaagctgctgagcttggaggactcctgaagtatgtacggcctttcttgaattccatc
agtaaagctaaagcagctcgtctggtccggtctcttcttgatctgtttctagatatggaa
gcagccacagggcaggaggtcgagctatgtttagagtgcatcgaatgggccaaatcagag
aaaagaactttcttacgccaagcattggaggcaaggctggtgtctttgtattttgatacc
aagaggtaccaggaagcattgcatttgggttctcagctgcttcgggagttgaaaaagatg
gatgataaagcccttttggtggaagtacagcttttagaaagcaaaacttaccatgctctg
agtaatctgccgaaagcccgagctgccttaacctctgctcgaaccacagcaaatgccatc
tactgcccccctaaattgcaggccaccctggacatgcagtcaggcattattcatgcagca
gaggagaaggactggaaaactgcatactcatacttctatgaggcattcgaaggctacgac
tccattgatagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatg
ctcaacaccccagaagatgtccaggctttggtgagcggaaagcttgcacttcggtatgca
gggaggcagacagaagcattgaaatgtgtggctcaagctagcaagaacagatcactggca
gattttgaaaaggccctgacagactacagggcagagctccgggatgacccaatcatcagc
acacatttggccaagctgtacgataacttactggaacagaatctgatccgggtcatcgag
cctttttcccgagtccagattgaacacatatctagcctcatcaaactctccaaggccgac
gtggaaagaaaattatcacagatgattcttgacaagaagtttcatgggattttggaccag
ggggagggtgtcctgatcattttcgatgaacccccagtagataaaacttatgaagctgct
ctggaaactattcagaacatgagtaaagtagtggactccctctacagcaaagccaagaag
ctgacatag

KEGG   Mus musculus (mouse): 70247
Entry
70247             CDS       T01002                                 

Gene name
Psmd1, 2410026J11Rik, P11, P112, S, S1
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    70247 (Psmd1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    70247 (Psmd1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    70247 (Psmd1)
   05012 Parkinson disease
    70247 (Psmd1)
   05014 Amyotrophic lateral sclerosis
    70247 (Psmd1)
   05016 Huntington disease
    70247 (Psmd1)
   05017 Spinocerebellar ataxia
    70247 (Psmd1)
   05020 Prion disease
    70247 (Psmd1)
   05022 Pathways of neurodegeneration - multiple diseases
    70247 (Psmd1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    70247 (Psmd1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     70247 (Psmd1)
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2 HEAT_EZ PA26 Tim54
Other DBs
NCBI-GeneID: 70247
NCBI-ProteinID: NP_081633
MGI: 1917497
Ensembl: ENSMUSG00000026229
Vega: OTTMUSG00000033949
UniProt: Q3TXS7
Position
1; 1 C5
AA seq 953 aa
MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFA
ALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPE
GEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYS
LKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKED
NLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDPMETE
EKTASAVAGKTPDASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAV
RNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLG
LGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQ
HEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIR
RLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICC
AGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDK
HDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLS
LAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLSMTETCRY
QPFKPLSIGGIIILKDTSEDVEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgatcacttcagccgctggaattatttctcttctggatgaagaagagccacagcttaag
gaatttgcactacacaaattgaatgcagtcgtgaatgacttctgggcagagatttctgag
tctgtagataaaatagaagttttatatgaagatgaaggtttccgaagtcggcagtttgca
gccctggtggcctcgaaagtgttttatcacctgggggcttttgaggagtctctgaattat
gctcttggagcaggtgacctcttcaacgtcaatgataactctgaatatgtggagactatt
atagcaaaatgcattgatcattataccaaacagtgtgtggaaaatgcagatttgcctgaa
ggagaaaaaaagccaattgaccagcgattggaaggcatcgtgaataaaatgttccagcga
tgtctcgatgatcacaagtataagcaagcgattggcattgctctggagaccaggagactg
gatgtctttgagaagactatactggaatctaatgatgtcccaggaatgctagcttacagc
ctcaaactctgcatgtctttaatgcagaataaacagtttcggaataaagtattgagagtc
ttggttaaaatctacatgaacttggaaaagcctgatttcatcaatgtttgtcagtgctta
attttcttagatgatcctcaggctgtgagtgatattttagaaaaactggtaaaggaggac
aacctgctgatggcctatcagatttgttttgatttgtacgaaagtgctagccagcagttc
ttgtcatctgtcatccagaatcttcgaactgttggtacccctattgcttctgtgcctgga
tctaccaatacggggactgtgccaggatcagagaaagacagtgaccccatggagacggag
gagaagacagccagtgcagtggctgggaagacaccagatgcgagtccagagcccaaggac
cagacactgaaaatgattaagattttaagtggtgaaatggctattgaattacacctgcag
ttcctaatacgaaataataacacagacctcatgattctgaaaaacacaaaggatgcagta
cgaaattctgtgtgtcatacagcaactgtaatagcaaactcattcatgcactgtggtact
accagtgaccagtttcttagagataacttggaatggttggccagagccaccaactgggcc
aaatttactgcaacggccagcttgggtgtaatccataagggccatgagaaggaagcacta
cagttaatggcaacataccttcctaaggacacttctccaggatcagcctatcaggaaggg
ggcggtctctatgcattgggtctcattcatgccaatcatggtggtgacataattgactat
ctccttaatcagctcaagaatgccagcaatgatattgttcgacatggaggcagcctgggc
cttggtttggctgcaatgggaactgcacgtcaggatgtgtatgatttgctgaaaacaaac
ctgtatcaggatgatgctgtgacaggggaggcagctggcctagccttaggtttggttatg
ttaggttctaaaaatgcccaggcgattgaggatatggttggctatgcacaagagactcaa
cacgagaagattctgcgcggtctggcagttggcattgcgttagtgatgtacgggaggatg
gaggaggctgatgctctcattgagtctctctgtcgtgacaaggacccaattcttagaaga
tctggaatgtatactgtagccatggcttattgtggctctggtaacaacaaagccattcgg
cgcctgctacatgttgctgtaagtgatgtcaatgatgatgtcagaagagcagcagtggag
tcacttggcttcattttgttcaggacgcctgaacagtgtccaagtgtggtttctttgttg
tcagagagttataaccctcacgtgcgctatggagctgcaatggccctgggaatctgctgt
gctggtacaggaaacaaggaagcaattaatttactagagccaatgaccaacgaccctgtg
aactacgtgaggcaaggggctctgatagcttcagctctcatcatgatccaacagactgag
atcacgtgtccaaaggtgaatcagttccggcagctgtattccaaagtcatcaatgacaaa
catgatgatgtcatggccaaatttggcgctattctggcccaaggcatactggatgcaggt
ggtcataatgtcacaatctccttacagtccaggactgggcacactcatatgccgtctgtg
gttggcgtccttgtcttcacccagttctggttctggtttcccctttcacacttcctgtca
ttggcttatactcctacctgtgtcattggccttaacaaggatttaaagatgccgaaagtt
caatataaatcaaattgtaaaccatccacattcgcatatcctgcccctctggaagtacca
aaagaaaaagaaaaggaaaaggtttccaccgctgtgttgtctattactgccaaagctaaa
aaaaaagaaaaagaaaaagaaaaaaaggaggaggagaagatggaagtggatgaagcagag
aagaaggaagagaaagagaagaaaaaagaacctgaaccaaacttccagctgttggataat
ccagcacgagttatgcctgcccagctgaaggtcttaagtatgacagagacctgcagatac
cagccttttaaaccactctccatcgggggcatcataattctgaaagacaccagcgaagac
gttgaagaactcgtggaacccgtggcagcacacggcccaaagattgaagaggaagagcaa
gagccagagcccccagagccgttcgagtatatcgatgactaa

DBGET integrated database retrieval system